KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_128630Help
Entry
CHLREDRAFT_128630 CDS       T01039                                 

Gene name
GLH1
Definition
glycoside-hydrolase-like protein
Orthology
K05546  
alpha 1,3-glucosidase [EC:3.2.1.84]
Organism
cre  Chlamydomonas reinhardtii
Pathway
N-Glycan biosynthesis
Metabolic pathways
Protein processing in endoplasmic reticulum
Module
N-glycan precursor trimming
Brite
KEGG Orthology (KO) [BR:cre00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    CHLREDRAFT_128630 (GLH1)
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CHLREDRAFT_128630 (GLH1)
Enzymes [BR:cre01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.84  glucan 1,3-alpha-glucosidase
     CHLREDRAFT_128630 (GLH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 903 aa AA seqDB search
MRRAIALGVGLALLGLLLPGSLAFKENEFKKCAQTSFCSRNRNVQQGANFEIVPASVTLN
TATLTATLMNKQASKHLQLTLTAHADGFVRLLIDELPSVGRYQVPSDILVSGWETRKAAI
KEESRSANGVVLVTGDTKLELNYAPFTLAVSVKGVPALQLNSRNLFNFEHRRPKQDSDPA
GYWEETWMGHTDTKPKGPEAMSLDLVFPGFSHVYGIPERATSLSLKATNGNAPYGEPYRL
YNLDVFEYLDDHPFGLYGSIPVMLAHKKGLTVGVYWNNAAEMFVDVVKGRDVGTQWIAES
GVVDLFVFTGATGPAVLASYAKVAGTTALPQLFSLGYHQCRWNYKDEADVKAVDGGFDAH
EIPYDVLWLDIEHTNGKRYLTWDSSLFPNPVAMQEDVASRGRKMVTIVDPHVKRDSSYYI
FSEAESAGHYVKNKHGSDFDGWCWPGQSSYLDVTSPVVRNWWAQQFTTDKYQGSTKHLYI
WNDMNEPSVFNGPEITMHKDNLHYGNVEHRDNHNLFGVYYHMGTADGLKLRGSQNGDRPF
VLSRAFFSGTQRVGPIWTGDNAAQWSHLKVSVPMLLTLGLTGLPYSGADVGGFFGNPDAE
LMTRWYQLGIYYPFFRGHAHLETQRREPWLFGPDVTARIRAAIRGRYALLPHIYTLFRAA
NTTGQPILRPLWFEFPEQEDLYAEEEEFMVGSSMLVKPVTAPSTFTVDVTFPQGSRWYDA
TTGAPVPPKTKTQRVEVNLNGIPVYYRGGSVVPRRERPRRSTAAQLADPYTLVVAADDKG
EAEGQLYVDDGRSFAFQRGLYLHRDFKFSGNKLTSTKHVEPGVPDGTLTVPTTIERVVFL
GLPAAKKGYKAVISDGVSGAKHTVALEAGPLSMAAAPDSTQALVLRKPDLPVSHDWTVEI
VQV
NT seq 2712 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgggcgatcgcgctgggcgttgggcttgccctccttgggcttctgctgccggga
tcgctggcgttcaaggagaatgagtttaagaagtgcgcccagacgagcttctgctcccgg
aacaggaatgtgcagcagggcgccaacttcgagattgtcccggcctcagttacgctaaac
acggcgacgctgaccgcgacgctcatgaacaagcaggccagcaagcacctgcagctcacg
ctgacggcgcacgccgatggcttcgtgcgcctgctcatagacgagttgccatcagtgggc
cgctaccaggtccccagcgacatcctggtgtctgggtgggagacccgcaaggcggcgatc
aaggaggagagccgcagcgccaacggcgtcgtgctggtgactggggacaccaagctggag
ctcaactacgcaccgttcacactggcggtcagcgttaagggcgtgccggcgctgcagctc
aacagccgcaacctgttcaactttgagcaccgccgccccaagcaggactccgaccctgcg
ggctactgggaggagacgtggatgggccacaccgacaccaagcctaagggccctgaggcc
atgtcgctggacctggtgttccccggcttcagccacgtgtacggcatccccgagcgcgcc
accagcctgtcgctcaaggccaccaacggcaacgctccgtacggcgagccctaccgcctg
tacaacctggacgtgttcgagtacctggacgaccaccccttcggcctgtacggctccatc
ccagtcatgctggcgcacaagaagggcctcaccgtgggcgtgtactggaacaacgcggcc
gagatgtttgtggacgtggtgaaggggcgcgacgtgggcacgcagtggattgctgagagc
ggcgtggtggacctgtttgtgttcacgggcgccacgggcccggcggtgctggcctcgtac
gccaaggtggccggcaccacggccctgccgcagctgttctctctgggataccaccagtgc
cgttggaactacaaggacgaggcggacgtgaaggccgtggacggcggcttcgacgcgcac
gagatcccctacgacgtgctgtggctcgacattgagcacaccaacggcaagaggtacctt
acctgggacagctccctgttccccaacccagtggccatgcaggaggacgtggccagccgc
ggccgcaagatggtcaccatcgtggacccgcacgtcaagcgcgactcatcgtactacatc
ttcagcgaggccgagagcgccgggcactacgtgaagaacaagcacggctcggacttcgac
ggctggtgctggcccggccagtccagctacctggacgtgaccagccccgtggtgcgcaac
tggtgggcgcagcagttcaccacggacaagtaccagggcagcaccaagcacctgtacatc
tggaacgacatgaatgagccgtccgtgttcaacggacccgagatcaccatgcacaaggac
aacctgcactacggcaacgtggagcaccgcgacaaccacaacctgttcggcgtctactac
cacatgggcaccgcagacggactcaagctgcgcggcagccagaacggcgaccgccccttc
gtgctgtcgcgcgccttcttctcgggcacccagcgcgtgggccccatctggacgggcgac
aacgcggcgcagtggagccacctcaaggtgtcggtgcccatgctgctcacgctgggcctc
accggcctgccctactcgggcgccgacgtgggcggcttcttcggcaaccccgacgccgag
ctcatgacccgctggtaccagctgggcatctactaccccttcttccgcggccacgcccac
ctggagacccagcgccgcgagccctggctgttcggccctgacgtcaccgcccgcatccgc
gccgccatccgcggccgctacgcgctgctgccgcacatctacacgctcttccgcgcggcc
aacaccaccggccagcccatcctgcgcccgctgtggttcgagttcccggagcaggaggac
ctgtacgccgaggaggaggagttcatggtgggcagctccatgctggtcaagcccgtcacc
gcgccctccaccttcacagtggacgtcaccttcccccagggctcccgctggtacgacgcc
accaccggcgcccccgtgccgcccaagaccaagacgcagcgcgtcgaggtgaacctgaac
ggcatcccggtctactaccgcggcggctccgtggtgccccgccgcgagcgcccccgccgc
tccaccgcggcgcagctggccgacccctatacgctggtggtggcggcggacgacaagggc
gaggcggagggccagctgtacgtggacgatggccgctccttcgcgttccagcgcggcctg
tacctgcacagggacttcaagttctccggcaacaagctcacctccaccaagcatgtggag
ccgggcgtgccggacggcaccctcaccgtgcccaccaccattgagcgtgtggtgttcctg
ggcctgcccgccgccaagaagggctacaaggccgtcatcagcgacggcgtcagcggcgcc
aagcacaccgtggcgctggaggcggggccgctcagcatggcggcggcgcccgactctacg
caggcactggtgctgcgcaagcccgacctgcccgtgtcgcacgactggaccgtggagatt
gtgcaggtgtaa

DBGET integrated database retrieval system