KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_128636Help
Entry
CHLREDRAFT_128636 CDS       T01039                                 

Gene name
EIF3B
Definition
eukaryotic initiation factor
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
cre  Chlamydomonas reinhardtii
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:cre00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CHLREDRAFT_128636 (EIF3B)
Translation factors [BR:cre03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    CHLREDRAFT_128636 (EIF3B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 718 aa AA seqDB search
MVQSEEYDPYEVAKQLYPDLPQGFPYDNFDLEELILPPGDDMGIKSDDDDVRDEDVQTQS
GFGSCIVIQNLPKAPEEKYEKLMGVVRTIASKLGDVRENGIFMPLDDATKTTKGFAFVEM
ARKEDADAALSDERFINGYQLDKNHKLTLSRFDDFDKYAKVPDEYVQPEPVAYKQPENLH
SWLADKYGRDQYVIRHGDNTAVCFNDGKRSRAEVAYQREYWTESFVQWSPQGTMLATMHR
QGMAVWGGPNFTRINRFGHQNVRLIDFSPNEKYILSYTSHEPATARDSFHVLINVWDVRS
GKQLRKFEGPVDEYAVGSSAGPNGALKWPVFKWAGGRDDLFFARLGRGKISIYECPSMTM
LGKESLKLDGVQDFEWSPVEPVLAAYSAEQGNQPARIVLIKVPEKTEMRQKNMLNVSDVK
LFWHPQGTYLAVKVEAWTKTKKSTITSFQIFCVKDKDVPLEVFELKNNKERVLNFAWEPK
GHRFAVVHGDGPRPNISFFSMRDDKGRLGVRELKMLESRACNAISWSPQGRIIVLAGLKN
FNGQLEFFNVDEMETMATAEHFMATDVEWDPTGRYVATVVSHVQQMENGVKIWSFGGREL
YSSQRDKLYQFSWRPRMPSLLPAEKEAEIAKNLKQYTKRYDEEDEQLLQQADADVLQERQ
RALDEWKAYCESRRNYAALQMDFKRELYGPRFAEKEYTIQKVMVEQVVDQKEEPYSTK
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atggtgcaatctgaggaatacgatccctatgaggttgcaaagcaactctacccggacttg
ccgcaaggatttccctatgacaacttcgacctagaggagctcattctgcctccgggcgat
gatatgggaatcaagagcgacgatgatgacgttcgtgacgaggacgtgcagacgcagtcg
ggcttcggatcgtgcatcgtcattcagaacctgcccaaggcgccggaggagaagtatgag
aagctcatgggcgtggtgcgcaccattgccagcaagctcggcgacgtgcgcgagaacggc
atcttcatgccgctggatgacgcaactaagaccacgaagggttttgcgtttgtggagatg
gcacgcaaggaggacgcggacgcggctctgtcggacgagcgctttattaacgggtaccag
ctggacaagaaccacaagctgacgctgagccgcttcgacgactttgataagtacgcgaag
gtgcctgatgagtacgtgcagccggagcccgtggcctacaagcagccggagaacctacac
agctggctggccgacaagtacggccgcgaccagtacgtgatccgccacggcgacaacacg
gcggtgtgcttcaatgacggcaagcgcagccgcgcggaggtggcgtatcagcgcgagtac
tggacggagtcgttcgtgcagtggtcgcctcagggcaccatgctggccacaatgcatcgc
cagggtatggctgtgtggggcgggcccaacttcacccgcatcaaccgcttcggccaccaa
aacgtgcgcctgatcgacttctcgcccaacgagaagtacatcctctcctacacctcgcac
gagcccgccaccgcgcgcgactcgttccacgtgcttattaacgtgtgggacgtgcgctcc
ggcaagcagctgcgcaagttcgagggccccgtggacgagtacgcggtgggctccagcgcc
ggccccaacggcgcgctcaagtggccagtgttcaagtgggcgggcggccgcgatgacctg
ttcttcgcgcgcctgggccgcggcaagatctccatctacgagtgcccctccatgaccatg
ctgggcaaggagtcgctcaagctggacggcgtgcaggactttgagtggagccccgtggag
ccggtcctggcggcctacagcgcggagcagggcaaccagccggcgcgcattgtgctgatc
aaggtgccggagaagacggagatgcgccagaagaacatgctcaacgtcagcgacgtgaag
ctgttctggcacccccagggcacctacctggcggtcaaggtggaggcgtggaccaagacc
aagaagtccaccatcaccagcttccagatcttctgcgtcaaggacaaggacgtgccgctg
gaggtgttcgagctgaagaacaacaaggagcgcgtgctcaacttcgcgtgggagcccaag
ggccaccgcttcgcggtcgtgcacggcgacgggccacgccccaacatctcgttcttcagc
atgcgcgacgacaagggccgcctgggcgtgcgcgagctgaagatgctggagagccgcgcc
tgcaacgccatcagctggtcgccgcagggccgcatcatcgtgctggccggcctcaagaac
ttcaacggccagctggagttcttcaatgtggacgagatggagaccatggcgacggcagag
cacttcatggccacggacgtggagtgggaccccaccggccgctacgtggcgacagtggtg
tcgcacgtgcagcagatggagaacggcgtcaagatttggtccttcggcggccgcgagctc
tacagctcccagcgcgacaagctctaccagttcagctggcggccgcgcatgcccagcctg
ctgccggccgagaaggaggcggagatcgccaagaacctcaagcagtacactaagcgctac
gatgaggaggacgagcagctgctgcagcaggctgacgctgacgtgctgcaggagcgccag
cgcgcgctggacgagtggaaggcctactgcgagagccgccgcaactacgcggctctgcag
atggacttcaagcgcgagctgtacgggccgcgcttcgcggagaaggagtacaccatccag
aaggtgatggtggagcaggtggtggaccagaaggaggagccctacagcaccaagtag

DBGET integrated database retrieval system