KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_128764Help
Entry
CHLREDRAFT_128764 CDS       T01039                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cre  Chlamydomonas reinhardtii
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cre00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    CHLREDRAFT_128764
Enzymes [BR:cre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     CHLREDRAFT_128764
Exosome [BR:cre04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CHLREDRAFT_128764
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 480 aa AA seqDB search
MSSNAISYTECIAALDQGTQSTRVYIFDKECNVLASHQAELPQIYPQAGWCEHDPLEIWR
TVLQCISQAWEQHVVSSGRPPLRMLSLGIPTQRETTVVWSRSTGQPLHNAIVWLDNRTSE
LCEHLSRVFGGVDAFRSVTGLPISPYFSATKYLWMLENIPQVAAAVESGDAAVGTIDSWL
IWQLTGGADGGVHVTDVTNASRMLLMDLDALDWHEPTLAAFRCPRAVLPRIVSNSEVYGT
ISASGPTCGVPIAGSLGDQMAAVLGQRCRPGEAKNTYGTGCFMLLNTGQRRIASNHGLLT
TVAFKLGPDKPANYALEGSVAVAGLGVSWLRDNLGLIGSAAESEVLAASVRDSGGVYLVP
ALSGLLAPRWRADARGVLVGLTSFTTRAHVVRAMLEAICFQTREVLDAMRRDAELDEHHG
GLAALRVDGGAAANDVLMQMQADLLQVPVLRPAFRETTSMGAALAAGLAVGFWTKEEVFS
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctaacgccatctcatacaccgaatgtatagcagcattagatcaaggcacacaa
tccactcgagtctacattttcgacaaggaatgcaacgtcctggcctcgcaccaggcggag
ctcccgcaaatctatccacaagcagggtggtgcgaacacgacccacttgagatttggcgc
acggtgctgcaatgcatcagccaggcttgggagcagcacgtggtgtccagcgggcggccg
ccgctgcgcatgctgtcgctgggcatccccacccagcgtgagaccacggtggtgtggagt
cgctccacgggccagcctctgcacaacgccattgtgtggctggacaaccggaccagcgag
ctgtgcgagcacctgtcgcgggtgtttggcggcgtggacgccttccgctccgtgaccggc
ctgcccatctcgccctacttcagcgcaaccaagtacctgtggatgctggagaacatcccg
caggttgcggccgccgtggagagcggcgacgcggccgtgggcaccattgacagctggctc
atctggcagctgaccggcggggcggacggaggcgtgcacgtcacggacgtgaccaacgcc
tcccgcatgctgctgatggacctggacgcgctggactggcacgaacccacgctggccgcc
ttccgctgcccccgcgccgtgctgccgcgcatcgtgtccaactcggaggtgtacggcacc
atcagcgccagcgggccgacatgtggcgtgcccatcgccggcagcctgggagaccagatg
gcggccgtgctgggccagcgctgccggcccggcgaggccaagaacacgtacggcaccggc
tgcttcatgctgctgaacacggggcagcgccgtatcgcctccaaccacggcctgctcacc
accgtggccttcaagctggggcccgacaagccagccaactacgccctggagggctcggtg
gcggtggcgggcctgggtgtgagctggttgcgagacaacctggggctcatcggcagtgcg
gcggagagcgaggtgctggcggcgtcagtgagggacagcggcggcgtgtacctggtgccc
gcgctgtcgggtctgctggcaccgcgctggcgggcggacgcgcgcggcgtgctggtgggg
ctcactagcttcaccacccgggcgcacgtggtccgcgccatgcttgaggcgatctgcttc
cagacgcgagaggtgctggacgccatgcggcgggatgcggagctggacgagcaccacggc
gggctggcggcgctgcgggtggacggcggcgcggccgccaacgacgtgctgatgcagatg
caggcggacctgctacaggtgccggtgctgcggccggccttccgcgagaccaccagcatg
ggggcggcgctggcggcggggctggccgtggggttctggaccaaggaggaggtgttcagt

  All links  
No link information was found.   
DBGET integrated database retrieval system