KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_130269Help
Entry
CHLREDRAFT_130269 CDS       T01039                                 

Gene name
DYRK1
Definition
dual-specificity tyrosine regulated protein kinase 1 (EC:2.7.1.-)
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
cre  Chlamydomonas reinhardtii
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 357 aa AA seqDB search
MTPYEHSEVLEYQQVYFVGRSSAQKVNGNPHAGGRSNFGYDDERGDYVVVLHDHMAYRYE
VLSVMGRGSFGQVLKVHDFKTNTLRAVKVIRNKKRFHQQALVELRVLQHIRDADPEDRQN
CVHIGEHFYFRGHLCISFELLSVNLYDFIKQNNFMGLSLGLIRRFAHQILISLRYMKVRS
LRLIHCDLKPENILLRQPNRSAIKVIDFGSSCYIEERVYTYIQSRFYRSPEVILGCAYGV
EIDMWSLGCILAELFTGYPLFPGEDEVEQLACMMEVVGLPPVSLLEAASRRKLFFDSAGN
PRLQPNSQGRTRMPGTKTLQGLLKCNDPGFLDLLEKCLRWDPATRITPEQALQHVWI
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgacgccgtacgagcacagcgaggtgctggagtaccaacaggtgtactttgtgggccgc
tcctccgcccagaaggtgaacggcaacccgcacgccggcggccgctccaacttcggctac
gacgatgagcgcggcgactacgtggtggtgctgcacgaccacatggcctaccgctacgag
gtgctgtcggtcatggggcgcggcagcttcggccaggtgctcaaggtgcacgacttcaaa
accaacacgctgcgtgccgtcaaggtgatccgcaacaagaagcgcttccaccagcaggcg
ctggtggagctgcgggtgctgcagcacatccgggacgccgacccagaggaccgccagaac
tgcgtgcacatcggggagcacttttacttccgcgggcacctctgcatcagcttcgagctg
ctgagcgtcaacctgtacgacttcatcaagcagaacaacttcatggggctcagcctgggc
ctcatccgccgcttcgcgcaccagatcctcatcagcctgcgatacatgaaggtgcggtcg
ctgcggctgatccactgcgacctgaagccggagaacatcctgctgcggcagcccaaccgc
tccgccatcaaggtcatcgacttcggctcctcctgctacatcgaggagcgcgtgtacacc
tacatacagagccgcttctaccgttcacccgaggtgattctgggctgtgcgtacggtgtg
gagatcgacatgtggagcctgggctgcatcctggcggagctgttcaccgggtacccgctg
ttcccgggtgaggacgaggtggagcagctggcgtgtatgatggaggtggtgggcctgccg
cccgtgtcgctgctggaggccgccagccgccgcaagctgttcttcgacagcgccggcaac
ccgcgactgcagcccaacagccagggccgcacgcgcatgccaggcaccaagacgctgcag
ggccttctcaagtgcaacgaccccggcttcctggacttgctggagaagtgcctgcgctgg
gaccccgccacccgcatcacgccggagcaggcgctgcagcacgtgtggatc

DBGET integrated database retrieval system