KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_130269Help
Entry
CHLREDRAFT_130269 CDS       T01039                                 

Gene name
DYRK1
Definition
(RefSeq) dual-specificity tyrosine regulated protein kinase 1
  KO
K18669  dual specificity tyrosine-phosphorylation-regulated kinase 2/3/4 [EC:2.7.12.1]
Organism
cre  Chlamydomonas reinhardtii
Brite
Enzymes [BR:cre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     CHLREDRAFT_130269 (DYRK1)
Protein kinases [BR:cre01001]
 Serine/threonine kinases: CMGC group
  DYRK family [OT]
   CHLREDRAFT_130269 (DYRK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Choline_kinase Pox_ser-thr_kin
Motif
Other DBs
NCBI-GeneID: 5720525
NCBI-ProteinID: XP_001695011
JGI: 130269
UniProt: A8J0Y2
Position
Unknown
AA seq 357 aa AA seqDB search
MTPYEHSEVLEYQQVYFVGRSSAQKVNGNPHAGGRSNFGYDDERGDYVVVLHDHMAYRYE
VLSVMGRGSFGQVLKVHDFKTNTLRAVKVIRNKKRFHQQALVELRVLQHIRDADPEDRQN
CVHIGEHFYFRGHLCISFELLSVNLYDFIKQNNFMGLSLGLIRRFAHQILISLRYMKVRS
LRLIHCDLKPENILLRQPNRSAIKVIDFGSSCYIEERVYTYIQSRFYRSPEVILGCAYGV
EIDMWSLGCILAELFTGYPLFPGEDEVEQLACMMEVVGLPPVSLLEAASRRKLFFDSAGN
PRLQPNSQGRTRMPGTKTLQGLLKCNDPGFLDLLEKCLRWDPATRITPEQALQHVWI
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgacgccgtacgagcacagcgaggtgctggagtaccaacaggtgtactttgtgggccgc
tcctccgcccagaaggtgaacggcaacccgcacgccggcggccgctccaacttcggctac
gacgatgagcgcggcgactacgtggtggtgctgcacgaccacatggcctaccgctacgag
gtgctgtcggtcatggggcgcggcagcttcggccaggtgctcaaggtgcacgacttcaaa
accaacacgctgcgtgccgtcaaggtgatccgcaacaagaagcgcttccaccagcaggcg
ctggtggagctgcgggtgctgcagcacatccgggacgccgacccagaggaccgccagaac
tgcgtgcacatcggggagcacttttacttccgcgggcacctctgcatcagcttcgagctg
ctgagcgtcaacctgtacgacttcatcaagcagaacaacttcatggggctcagcctgggc
ctcatccgccgcttcgcgcaccagatcctcatcagcctgcgatacatgaaggtgcggtcg
ctgcggctgatccactgcgacctgaagccggagaacatcctgctgcggcagcccaaccgc
tccgccatcaaggtcatcgacttcggctcctcctgctacatcgaggagcgcgtgtacacc
tacatacagagccgcttctaccgttcacccgaggtgattctgggctgtgcgtacggtgtg
gagatcgacatgtggagcctgggctgcatcctggcggagctgttcaccgggtacccgctg
ttcccgggtgaggacgaggtggagcagctggcgtgtatgatggaggtggtgggcctgccg
cccgtgtcgctgctggaggccgccagccgccgcaagctgttcttcgacagcgccggcaac
ccgcgactgcagcccaacagccagggccgcacgcgcatgccaggcaccaagacgctgcag
ggccttctcaagtgcaacgaccccggcttcctggacttgctggagaagtgcctgcgctgg
gaccccgccacccgcatcacgccggagcaggcgctgcagcacgtgtggatc

DBGET integrated database retrieval system