KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_131695Help
Entry
CHLREDRAFT_131695 CDS       T01039                                 

Gene name
FAP295
Definition
cyclic nucleotide dependent protein kinase
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
cre  Chlamydomonas reinhardtii
Brite
Enzymes [BR:cre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     CHLREDRAFT_131695 (FAP295)
Protein kinases [BR:cre01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   CHLREDRAFT_131695 (FAP295)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 718 aa AA seqDB search
MGNTQGKGDGAMTGRAKAITGGAVKGKATLPKLPTNAVKSQPEDYAFIENALGRLLLFGK
LDSQVQRKIVSEMYERTVPAGDILIKEGDTGLAACELYVVKSGKFEVLQKRQGQNVRVNI
KERGDCFGEISLMYDSPRTATVAATMDAVVWALDRQVFRFFVRELQETQVSQVELFLNSV
PILANLSREERIRLVDAFEENTYQAGQKVIVEGDKGDLFYIVKEGEAIVYQNTPGGQRKV
NHLFKADFFGERALLKDEPRMATVEAYTKLVCLTLKRETFQEILGPLEQLMAREKSNQVV
AQKMAKLQPRGSHVHRPPAEVLIKRNKKGRNGNTIEVVRARGHLDEVLELRKGGTKLEGM
DPGASGKEANTLVLTEGTVLGGGAFSRVSIVTEESTGRTYALKRMRKSAVVQCPEHVFCE
QAITKNVAHPFCIRQYASFQDKYHLYFLFDLMPGGDLMDVLVAEAKVIKRRVPQGTWRIG
CLAPKVKMLQGMSEDLARFYIGSIVLALEYLHNNNIVYRDLKPENVFIDASGYVKLGDFG
FAKVLENGNRTYTFCGTPGYVAPENVLAHGYNYSVDWWGLGVLMYVLLTGRQPFSTPKTD
DPMVVMRRIVDENYQIKYPPYLSPAAKDLISRLLERKPAKRMGMLNARAMDIKNHKWFEN
LAWEELEARRMAAPRKPKEADSAKRVKEMIENEKKTAGKTPKETPEELQECEMVFADF
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atggggaacacccaggggaagggggatggagcgatgacaggccgtgcaaaggctatcacg
ggaggagccgtcaagggcaaggccacgcttcctaagctcccgacgaatgcggtcaagtcg
caaccagaggactacgcattcatcgagaacgcgctgggtcgcctcctactgttcggcaaa
ctggactcgcaagtacagcggaagattgtgtctgaaatgtatgagcggacggtgccggcg
ggtgacattctcatcaaggagggcgacacagggcttgcggcttgcgagctctacgtcgtg
aagagcgggaagttcgaggtgctgcaaaagcgccaaggccagaatgtgcgcgtgaacatc
aaggagcgcggcgactgcttcggcgaaatctcgctgatgtatgacagcccacgcacagcc
accgtcgcggccaccatggacgccgtggtgtgggccctggaccgccaggtcttcaggttc
ttcgtgcgggagctgcaggagacccaggtgtcgcaggtggagctgttcctcaactcggtg
cccattcttgccaacttgtcccgcgaggagcgcatccggctggtggacgcgttcgaggag
aacacataccaggcggggcaaaaggtcattgtagagggcgacaagggtgacctgttctac
atcgtgaaggagggcgaggcgatagtgtaccagaacacgccaggcgggcaacggaaggta
aaccaccttttcaaagcggacttcttcggcgagcgcgcgctgctcaaagacgagccacgc
atggcgacggtggaggcatacaccaagctggtgtgcctgacgctaaagcgtgagacgttc
caggagatcctgggcccgctggagcagctcatggcgcgtgaaaagtcgaaccaggtggtt
gcgcagaagatggcgaagctgcagccgcgcggctcgcacgtgcaccgaccgccagcggag
gtgctcattaagcgcaataagaaggggcgcaacggaaacacgattgaggtggtgcgcgcc
cgcgggcacctggatgaggtgctggagctgcggaaaggcggcaccaagctcgagggcatg
gacccgggggcgtcgggcaaggaggcgaacacgctggtgctcacggaggggacggtgctg
ggaggcggtgccttcagtcgcgtgtccatcgtgaccgaggagtccacggggcgcacctac
gcgctcaagcgcatgcgcaaatcagcggtggtgcagtgcccggagcacgtgttctgcgag
caggcgatcacgaagaacgtggcgcacccgttctgcatccgccagtacgcgtctttccag
gacaagtaccacctgtacttcctgttcgacctgatgcccggtggcgatctgatggatgtg
ctggtggcggaggcgaaggtcatcaagcgccgcgtgccgcagggcacctggcggataggc
tgcctggcccccaaggtcaagatgctgcagggcatgagcgaggacctggcgcgcttctac
atcggctccatcgtgctggcgctcgagtacctgcacaacaacaacatcgtctaccgcgac
ctgaagcccgagaacgtgttcatcgacgccagcggctacgtgaagctgggcgacttcggc
tttgccaaggtgctggagaacggcaaccgcacgtacaccttctgcggcacgcccggctac
gtggcgccggagaacgtgctggcgcacggctacaactacagcgtggactggtggggcctg
ggcgtgctcatgtacgtgctgctgaccggccgccagccgttcagcacgcccaagactgat
gaccccatggtggtcatgcgccgcatcgtggacgagaactaccagatcaagtacccgccc
tacctgtcgcccgcggcaaaggacctcatttctcggttgttggaacgcaagcccgccaag
cgcatgggcatgctgaacgcgcgcgccatggacatcaagaaccacaaatggtttgagaac
ctggcgtgggaggagctggaggcgcgccgcatggcggcgccgcgcaagcccaaggaggcg
gacagcgccaagcgcgtcaaggagatgatcgagaacgagaagaagacggcgggcaagacg
cccaaggagacgccggaggagctgcaggagtgcgagatggtgttcgcggacttctaa

DBGET integrated database retrieval system