KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_131913Help
Entry
CHLREDRAFT_131913 CDS       T01039                                 

Definition
hypothetical protein
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
cre  Chlamydomonas reinhardtii
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:cre01212]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:cre00062]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 272 aa AA seqDB search
MGDSCCSPYGIGAVAKYLQSRLGVFVYSIATGSSEFTDVLSSYWGDVNDQVASACAQLRN
LTQLSGGYNAVGLSQGGQFLRAVAERCQHTGPRMHTLITLGAQHQGVMNAPGCMSLPLNN
SHGTCHLMQKLLGAGAYLPYVRDHVVQAQYFKDPLRLPQYLSANPFLPDINNERGPGARN
PVYADNLASLARLVLFRFSEDITVVPRDSAWFSFFDGERLVPLQEQPLYTEDWIGLKRLD
QAGRLVFEEAPGQHMQFSLDWFGSNVVDRYLR
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgggtgattcttgctgctccccttacggtatcggggcagtcgcaaaataccttcaatcg
cgccttggagtgtttgtatacagcatcgcaactggcagcagcgagttcacggacgtgctg
agcagctactggggcgacgtaaatgaccaggttgcgtcagcgtgtgctcagctgcgcaac
cttacgcagttgtcgggcggctacaacgcagtgggcttgtcacagggaggccagttcctc
agggctgttgctgagcgctgccagcacaccggcccgcgcatgcacacgctgatcacgctg
ggcgcgcagcaccagggagtcatgaacgcgcccgggtgcatgtcgctgccgctcaataac
agccacggcacgtgccacctgatgcagaagctgctgggggcgggggcctacctgccgtac
gtgcgcgaccacgtggtgcaggcccagtacttcaaggacccgctgcggctgccgcagtac
ctgtccgccaaccccttcctgcccgacatcaacaacgagcgcggccccggcgcccgcaac
cccgtgtacgccgacaacctggcctcgctggcccgcctggtgctgttccgcttctcagag
gacatcacggtggtgccgcgggacagcgcctggttttcgttctttgacggcgagcgactg
gtgccgctgcaggagcagcccctctacacggaggactggatcggcctcaagcgactggac
caggccgggcggctggtgttcgaggaggcgcccggccagcacatgcagttcagcctggac
tggttcggatccaatgtggtggatagatacctacgctga

DBGET integrated database retrieval system