KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_131998Help
Entry
CHLREDRAFT_131998 CDS       T01039                                 

Gene name
MAPK5
Definition
mitogen-activated protein kinase 5 (EC:2.7.1.-)
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
cre  Chlamydomonas reinhardtii
Brite
Enzymes [BR:cre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     CHLREDRAFT_131998 (MAPK5)
Protein kinases [BR:cre01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   CHLREDRAFT_131998 (MAPK5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 353 aa AA seqDB search
MTEEEVDKHILKKYEIQQKLGKGAYGVVWKAIDRKTREVVALKKIFDAFQNATDAQRTFR
EVMFLQDLNNHDNIVRLLNVLKAENDRDLYLVFEYMETDLHAVIRANILEEVHKQYIMYQ
LFKSLKYMHSGELLHRDIKPSNLLLNSDCMVKLADFGLARSVSQLNASDGQNPILTDYVA
TRWYRAPEILLGSTKYTFGVDMWSSGCILGELLMGKPVFPGTSTMNQLDRIVEFCGRPSP
SDVEAIDSPFAATMMESCSVSQARRLQDVFPHASPDAADLLRKLLVFNPHKRLTAEQALR
HPYVAQFHNLADEPVCNRIIVLPISDNTKYTVSEYRERLYGEILKKKKEVVRQ
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgacggaggaggaagtcgacaagcatatcctcaagaaatatgagatccagcaaaagctg
ggcaagggggcctacggagttgtatggaaagcaattgaccggaagactcgtgaggtcgtg
gcgctgaagaagattttcgacgcctttcaaaacgcgacagatgcacagcgaacatttcga
gaagtgatgttcttgcaagacctgaacaaccatgacaacatcgtcaggttgttaaatgtc
ctcaaagcggagaatgatcgggacctgtacctcgtgttcgagtatatggagaccgaccta
cacgcggtcatccgggccaacatcctggaggaggtgcacaagcagtacatcatgtaccag
ctgttcaagagcctcaagtacatgcacagcggcgagctgctgcacagagacatcaagccc
agcaacctgctgctcaacagcgactgcatggtcaagctcgcggactttggcctggcccgg
agtgtgagccagctgaacgccagcgacggccaaaaccccatcctgacggactacgtggcc
acgcgctggtaccgcgcccccgagatcctgctgggtagcaccaagtacacgttcggcgtg
gacatgtggtccagcggctgtatcctgggtgagctgctgatgggcaagcccgtcttcccc
ggcacctccaccatgaaccagctggaccgcattgtggagttctgtgggcggcccagtccc
tcggacgtggaggccatcgactcgcccttcgccgccaccatgatggagtcctgcagcgtc
agccaggcgcgccgcctgcaggacgtcttcccgcacgcctcgccggacgcggcggacctg
ctgcgcaagctgctggtgttcaacccgcacaagcggctgactgcggagcaggcgctgcgg
cacccgtacgtggcgcagttccacaacctggcggacgagccggtgtgcaaccgcatcatc
gtgctgcccatctccgacaacaccaagtacacagtcagcgagtacagggagcggctgtac
ggcgagatcctgaagaagaagaaggaggtggtgcgccag

DBGET integrated database retrieval system