KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_132158Help
Entry
CHLREDRAFT_132158 CDS       T01039                                 

Definition
hypothetical protein
Orthology
K10527  
enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.35 1.1.1.211]
Organism
cre  Chlamydomonas reinhardtii
Pathway
Fatty acid degradation
alpha-Linolenic acid metabolism
Metabolic pathways
Fatty acid metabolism
Module
beta-Oxidation
Class
Metabolism; Overview; Fatty acid metabolism [PATH:cre01212]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:cre00071]
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:cre00592]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 705 aa AA seqDB search
MAPQPEAQYRVDPDGVAVITLNYPPLNALHPLLLRSLFEALRRAHADPAVKAVVLTGANN
NFCAGFDISQFQNPDAGSGGGIDNSINDAICKYLEGGAKPVVAAVQGVALGGGLEVAMGC
NARVAVRGTKLGLPELTLGIIPGFGGTQRLPRLVGLAKGCEMMLTSAPIKAEGREGRGIP
ALFRCPPPPYHSPLPLPPFLHSLHRPSLSTPSPPDKLPPLGEALALLDMARAEAGRRARG
LAHPQLCLDAVQAGVERGGQEGLAAEGRAFAAAAALDTHKALVHIFFAQRATKKVKGVTD
VPGLKPRPIRCVAVLGGGLMGSGIATALALAGVEVILKEVKKGAMSQAAADAALGRVSGA
LDYAGFARADMVIEAVIEDIPLKQKIFADLEKACRPDAILSTNTSTIDIELVGAKMSGGA
AARRRLLGAHFFSPAHIMPLLEIVRTKDTGAQVGAWGACGRGLRGRRAVVEWARRGLLVE
AHACDRTPQLENSRNTRWVTVATERITAPVHPLLQLNDLVGSDIGLHVGANFVTSFPDRV
YVSRLIPALNEAKRLGEKTGKGFYKFDAKTRKASPDPEGLAPLLEGSRREAALVPAGAKP
PALSDQDILDWIFFPVVNEGCRVVAEGIVDKAADLDVASVMAMGFPPVRGGLIFWADLVG
APRIVARLKQFAAMHAGFFAPCDYLLQAAASGRKLSAGPPAAAKL
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atggcaccgcagccggaggcccagtatcgggtagatcccgatggcgtggcggtcatcacg
ctcaactacccgccgctgaacgcgctgcatccgctgctgctgcgctcgctgtttgaggcg
ctgcgccgcgcgcacgccgacccggcggtgaaggcggtggtgctcaccggcgcaaacaac
aacttctgcgccggctttgacatcagccagttccagaacccggacgccggcagcggcggc
ggcatcgacaactccatcaacgatgccatctgcaagtacctggagggcggcgccaagccc
gtggtggcggccgtgcagggcgtggcgctgggcggggggctggaggtggccatggggtgc
aacgcccgtgtggcggtgcgcggcaccaagctgggtctgccggagctgacgctgggcatc
atcccgggctttggcggcacgcagcggctgccgcgcctggtggggctggccaagggctgc
gagatgatgctgaccagcgcgcccatcaaggccgaggggagggaggggaggggaatcccc
gccttgtttcgttgcccgcctccaccctaccattcacccctccccctccctccctttctc
cattccctccatcgcccctccctctccaccccctcccctccagacaagctgccccccctg
ggcgaggccctggcgctgctggacatggcgcgcgccgaggccggccgccgcgcccgcggc
ctggcgcacccgcagctgtgcctggacgcggtgcaggcgggcgtggagcggggcgggcag
gaggggctggcggcggagggccgcgccttcgcggcggccgccgcgctggacacgcacaag
gcgctggtgcacatcttctttgcgcagcgggccaccaagaaggtcaagggcgtcacggac
gtgccgggcctgaagccccgccccatccgctgcgtggcggtgctgggcggcggcctgatg
ggcagcggcatcgccacggcgctggcgctggcgggcgtggaggtgatcctcaaggaggtg
aagaagggcgccatgagccaggccgccgcggacgccgcgctgggccgtgtgagcggcgcg
ctggactacgccggctttgcgcgggcggacatggtgattgaggcggtcatcgaggacatc
ccgctcaagcagaagatctttgcggacctggagaaggcctgccgccccgacgccatcctc
tccaccaacacctcgaccatcgacattgagctggtgggggccaagatgtcgggcggcgcg
gcggcgcggcggcggctgctgggcgcgcacttcttcagcccggcgcacatcatgccgctg
ctggagatcgtgaggaccaaggacaccggcgcccaggtgggggcgtggggtgcgtgcggg
cgtgggctgcggggccggcgggcggttgtggagtgggctcggaggggtttgctcgtcgag
gcccatgcctgtgaccgtactccgcagcttgagaacagcaggaacactaggtgggtcaca
gtcgccaccgaacgaatcactgctccagttcaccctctcctccagctgaacgacctggtg
ggcagcgacattgggctgcacgtgggcgccaacttcgtcacctcgttcccggaccgcgtc
tacgtgtcgcgcctcatccccgcgctcaacgaggccaagcggctgggcgagaagaccggc
aagggcttctacaagtttgacgccaagacgcgcaaggccagccccgaccccgagggcctg
gcgccgctgctggagggcagccggcgcgaggccgccctggtgccggcgggcgccaagccg
ccggcgctgagcgaccaggacatcctggactggatcttcttcccggttgtgaacgagggc
tgccgggtggtggcggagggcattgtggacaaggccgccgacctggacgtggccagcgtc
atggccatgggcttcccgcccgtgcggggcggcctgatcttctgggctgacctggtgggg
gcgccgcgcatcgtggcccgcctgaagcagtttgcggccatgcacgccggcttcttcgca
ccctgcgactacctgctgcaggccgcggcgtccggccgcaagctcagcgccgggccgccc
gccgcagccaagctgtag

DBGET integrated database retrieval system