KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_134594Help
Entry
CHLREDRAFT_134594 CDS       T01039                                 

Gene name
CHLD
Definition
magnesium chelatase subunit D
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
cre  Chlamydomonas reinhardtii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cre00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CHLREDRAFT_134594 (CHLD)
Enzymes [BR:cre01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     CHLREDRAFT_134594 (CHLD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 767 aa AA seqDB search
MKSLCHELAGPSVTGCGRRSLRKAFSGAKIAQVSRPAVLNSVQRQQRLACSAVAELSAAE
LRAMKVSEEDSKGFDADVSTRLARSYPLAAVVGQDNIKQALLLGAVDTGLGGIAIAGRRG
TAKSIMARGLHALLPPIEVVEGSICNADPEDPRSWEAGLAEKYAGGPVKTKMRSAPFVQI
PLGVTEDRLVGTVDIEASMKEGKTVFQPGLLAEAHRGILYVDEINLLDDGIANLLLSILS
DGVNVVEREGISISHPCRPLLIATYNPEEGPLREHLLDRIAIGLSADVPSTSDERVKAID
AAIRFQDKPQDTIDDTAELTDALRTSVILAREYLKDVTIAPEQVTYIVEEARRGGVQGHR
AELYAVKCAKACAALEGRERVNKDDLRQAVQLVILPRATILDQPPPEQEQPPPPPPPPPP
PPPQDQMEDEDQEEKEDEKEEEEKENEDQDEPEIPQEFMFESEGVIMDPSILMFAQQQQR
AQGRSGRAKTLIFSDDRGRYIKPMLPKGDKVKRLAVDATLRAAAPYQKIRRQQAISEGKV
QRKVYVDKPDMRSKKLARKAGALVIFVVDASGSMALNRMSAAKGACMRLLAESYTSRDQV
CLIPFYGDKAEVLLPPSKSIAMARRRLDSLPCGGGSPLAHGLSTAVRVGMQASQAGEVGR
VMMVLITDGRANVSLAKSNEDPEALKPDAPKPTADSLKDEVRDMAKKAASAGINVLVIDT
ENKFVSTGFAEEISKAAQGKYYYLPNASDAAIAAAASGAMAAAKGGY
NT seq 2304 nt NT seq  +upstreamnt  +downstreamnt
atgaagtctctctgccatgagctcgctggccccagcgttactgggtgcggccggcgaagc
ctccggaaggctttcagcggtgccaagattgcgcaggtctctcgccccgctgtgcttaac
agcgtgcagcgccaacagcgtctcgcctgttctgccgtggccgagctctccgctgctgag
ctgcgcgccatgaaggtgtctgaggaggactccaagggcttcgatgcggatgtgtcgacc
cgcctggcccgctcgtaccctctggcggccgtggtgggccaggacaacatcaagcaggcg
ctgctgctgggcgccgtggacaccgggctgggcggcatcgccatcgccggtcgccgcggt
accgccaagtccatcatggctcgcggcctgcacgctctgctgccgcccattgaggtggtg
gagggcagcatctgcaacgccgaccccgaggacccccgctcctgggaggctggcctggct
gagaagtatgcgggcggccctgtgaagaccaagatgcgctcggcgccgtttgtgcagatc
cctctgggtgtgactgaggaccgcttggtgggcactgtggacattgaggcgtccatgaag
gagggcaagactgtgttccagcccggcctgctggctgaggcgcaccgcggcatcctgtac
gtggacgagatcaacctgctggatgacggcattgccaacctgctgctgtccatcctgtcg
gacggagtcaacgtggtggagcgcgagggcatctccatcagccacccctgccggccgctg
ctgattgccacctacaaccccgaggagggccctctgcgtgagcacctgctggaccgcatc
gccattggcctcagcgccgacgtccccagcaccagcgacgagcgcgtcaaggccattgac
gcagccatccgcttccaggacaagccgcaggacactattgacgacaccgcggagctcacc
gacgccctgcgcacctcggtcatcctggctcgcgagtacctgaaggacgtgaccatcgcg
ccggagcaggtgacctacattgtggaggaggcgcgccgcggcggagtccaggggcaccgc
gcggagctgtacgcggtcaagtgtgccaaggcgtgtgcggctctggagggccgtgagcgt
gtgaacaaggatgacctgcgccaggccgtgcagctggtcatcctgccgcgcgccaccatc
ctggaccagcccccgcccgagcaggagcagcccccgccgccgcccccgccccctcccccg
ccgccgccgcaggaccaaatggaggacgaggaccaggaggagaaggaggacgagaaggag
gaggaggagaaggagaacgaggaccaggacgagcccgagatccctcaggagttcatgttt
gagtccgagggcgtcatcatggacccctccatcctcatgttcgcgcagcagcagcagcgc
gcgcagggccgctccggccgcgccaagacgctcatcttcagcgacgaccgcggccgctac
atcaagcccatgctgcccaagggtgacaaggtcaagcgcctggcagtggacgccacgctt
cgcgccgccgcgccctaccagaagattcgccggcagcaggccatcagcgagggcaaggtg
cagcgcaaggtgtacgtggacaagccagacatgcgctccaagaagctggcccgcaaggcc
ggtgcgctggtgatttttgttgtggacgcgtccggctccatggctctgaaccgcatgagc
gccgccaagggcgcctgcatgcgcctgctggctgagtcgtacaccagccgcgaccaggtg
tgcctcatccccttctacggcgacaaggccgaggtgctgctgccgccctccaagtccatc
gccatggcccgccgccgcctggactcgctgccctgcggcggcggctcgccccttgcgcac
ggcctgtccacggcggtacgtgtgggcatgcaggccagccaggcgggcgaggtgggccgc
gtcatgatggtgctcatcacggacggccgcgccaacgtcagcctggccaagtccaacgag
gaccccgaggcgctcaagcccgacgcgcccaagcccaccgccgactcgctgaaggacgag
gtgcgcgacatggccaagaaggccgcgtccgccggcatcaacgtgcttgtcattgacacg
gagaacaagttcgtgagcaccggctttgcggaggagatctccaaggcagcgcagggcaag
tactactacctgcccaacgccagcgacgccgccatcgcggcggccgcgtccggcgccatg
gccgcggccaagggcggctactag

DBGET integrated database retrieval system