KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_137012Help
Entry
CHLREDRAFT_137012 CDS       T01039                                 

Gene name
GPX3
Definition
(RefSeq) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
cre  Chlamydomonas reinhardtii
Pathway
cre00480  Glutathione metabolism
cre00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:cre00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    CHLREDRAFT_137012 (GPX3)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CHLREDRAFT_137012 (GPX3)
Enzymes [BR:cre01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     CHLREDRAFT_137012 (GPX3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 5718788
NCBI-ProteinID: XP_001693150
JGI: 137012
UniProt: A8IWW7
Position
Unknown
AA seq 200 aa AA seqDB search
MLQTRAPVVSRPAIGRAVRPAARPVVRTQALFGFGKTAEPETTSEFYQFQVKDIDGKNFK
LSSLKDKAVLVVNLASACGFTPQYAELQDLQDKYGKQGFVVLGFPCNQFGAQEPGSNQTI
KQFAKSNYGVTFPLMSKVDVNGPGAEPLFDWLKTQKGGLLTSDIKWNFSKFLINKEGDVV
GRYGSTSSPLSLENDIKKAL
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgctgcagacgcgcgcccccgtcgtgtcgcgcccggccattggtcgcgctgtgcgcccc
gccgctcgccccgtcgttcggacccaggcactgtttggctttggcaagactgccgagcct
gagacgacctcggagttctaccagttccaggtcaaggacattgacggcaagaactttaag
ctatcgtccctcaaggacaaggcggttctggtcgtgaacctggccagtgcttgcggcttc
accccccagtacgccgagcttcaggacctgcaagacaagtacggcaagcagggctttgtg
gtcctgggcttcccctgcaaccagttcggcgcgcaggagccgggctccaaccagaccatc
aagcagttcgccaagtccaactacggcgtgaccttccccctcatgtccaaggtcgacgtg
aacgggcccggcgccgagcccctgttcgactggcttaagacccagaagggtggtctcctg
acctccgatatcaagtggaacttctccaagttcctgatcaacaaggagggcgacgtggtt
ggccggtacggctccacctcctcgcctttgtcgctcgagaacgacatcaagaaggctctg
taa

DBGET integrated database retrieval system