KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_137012Help
Entry
CHLREDRAFT_137012 CDS       T01039                                 

Gene name
GPX3
Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
cre  Chlamydomonas reinhardtii
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:cre00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    CHLREDRAFT_137012 (GPX3)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CHLREDRAFT_137012 (GPX3)
Enzymes [BR:cre01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     CHLREDRAFT_137012 (GPX3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 200 aa AA seqDB search
MLQTRAPVVSRPAIGRAVRPAARPVVRTQALFGFGKTAEPETTSEFYQFQVKDIDGKNFK
LSSLKDKAVLVVNLASACGFTPQYAELQDLQDKYGKQGFVVLGFPCNQFGAQEPGSNQTI
KQFAKSNYGVTFPLMSKVDVNGPGAEPLFDWLKTQKGGLLTSDIKWNFSKFLINKEGDVV
GRYGSTSSPLSLENDIKKAL
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgctgcagacgcgcgcccccgtcgtgtcgcgcccggccattggtcgcgctgtgcgcccc
gccgctcgccccgtcgttcggacccaggcactgtttggctttggcaagactgccgagcct
gagacgacctcggagttctaccagttccaggtcaaggacattgacggcaagaactttaag
ctatcgtccctcaaggacaaggcggttctggtcgtgaacctggccagtgcttgcggcttc
accccccagtacgccgagcttcaggacctgcaagacaagtacggcaagcagggctttgtg
gtcctgggcttcccctgcaaccagttcggcgcgcaggagccgggctccaaccagaccatc
aagcagttcgccaagtccaactacggcgtgaccttccccctcatgtccaaggtcgacgtg
aacgggcccggcgccgagcccctgttcgactggcttaagacccagaagggtggtctcctg
acctccgatatcaagtggaacttctccaagttcctgatcaacaaggagggcgacgtggtt
ggccggtacggctccacctcctcgcctttgtcgctcgagaacgacatcaagaaggctctg
taa

DBGET integrated database retrieval system