KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_137673Help
Entry
CHLREDRAFT_137673 CDS       T01039                                 

Gene name
CMK1
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
cre  Chlamydomonas reinhardtii
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:cre00900]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 347 aa AA seqDB search
MLQSGAAQRGVSRTSSLARKVAPARIAGARRRTSAVVVHANYKPNAVQLFSPSKINLFLR
VVRRREDGYHDLASLFHVIDLGDYMEFETTPHALQDTLECSDPTIPTDESNLVIKALNLY
RRKTLQTMYYKVKLHKRVPHGAGLGGGSGNAATTLFAANKLMGGIASNEDLLEWSGEIGS
DISVFFSNTGAAYCTGRGEVVEDVPPPVPLDTPMLLVKPPVGLATPKIFKSLDLDRRSSA
DPRGLLDTIAAAKGVDQAAAVNDLEQPAFDNLPELAALKQRLIESGQFRSVFMTGSGSTI
VCFGSDAVPAFLREEPQYKDLFISPTRLITRKPNGWYEHSGMWKEQL
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgttacaatcaggagctgcccagcgtggcgtctcgcggacgagttcgcttgcacggaaa
gttgcccctgctcgaattgcgggcgcgcgcagacgcacatcagcagttgtggttcacgcg
aactataagcctaacgcggtccagcttttttcgccctcaaagatcaacctgttcctgcgt
gtcgttcgtcgtcgtgaggatgggtaccatgacctggcgtcgctgttccacgtgattgac
ctgggtgactacatggagttcgagaccacccctcacgcgctgcaagacacgttggagtgc
tccgaccccaccatccccaccgacgagtccaacctggtcatcaaagcgctgaacctgtac
cggcgcaagacgctgcagaccatgtactataaggtcaagctgcacaagcgcgtgccgcac
ggcgccggcctgggcggcggcagcggcaacgctgccaccacgctgttcgcggccaacaag
ctcatgggcggcatcgcctccaacgaggacctgctggagtggtcgggcgagatcgggtcg
gacatctcggtcttcttctccaacaccggcgccgcctactgcaccggccgcggcgaggtg
gtggaggacgtgccgccgcccgtgccgctggacacgcccatgctgctggtcaagccgccg
gtggggctggccacgcccaagatcttcaagtcgttggacctggaccgccgctccagcgcc
gacccgcgcggcctgcttgacaccatcgccgccgccaagggcgtggaccaggccgccgcc
gtgaacgacctggagcagcccgccttcgacaacctgcccgagcttgccgcgctaaaacag
cggctgatcgagagcgggcagttcaggtccgtgttcatgaccggcagcggctccaccatc
gtgtgcttcggctccgacgccgtgccggccttcttgcgcgaggagcctcagtacaaggac
ctcttcatctcgcccacccgcctcatcacgcgcaagcccaacggctggtatgagcacagt
gggatgtggaaggagcagctgtga

DBGET integrated database retrieval system