KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_138157Help
Entry
CHLREDRAFT_138157 CDS       T01039                                 

Definition
hypothetical protein
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
cre  Chlamydomonas reinhardtii
Pathway
Basal transcription factors
Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:cre00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    CHLREDRAFT_138157
  Replication and repair
   03420 Nucleotide excision repair
    CHLREDRAFT_138157
Transcription machinery [BR:cre03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     CHLREDRAFT_138157
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 435 aa AA seqDB search
MDFAAYISGLPGPKRGALYRSPWTCLAVFRNLPPLAQVYVMRLLFVPSPFPADFVDSWAA
KGAASGHKAALSALRGLDVLTEERGRSRARAGQGRGRRATGQGPKGPVELSQLMRGDVPA
AAASCCPSLEELGEWAVGQWEALQLYLLGSSRSPPQLPQLLRVRARTCEDGAAAGRRSLA
VTQRSFHWLLQPGDRQLWAVLREYISGAEAASGDELAHTLSFLLQLGFRRVGQPCAWAEL
RPPEQRMAAHLAQLGVLAVFQGSAGAAGSGGALAARGGGAGGAAAAAAMDGGGAGSDAFV
IVESNYRVYVYTRSPVTIAVLELFVKREALLPNLFVGAIRRDSILAALARGITADELVAY
LSARPHPSIAARCPVVPEVVSDQIRLWEASMNRLQAHPAVLYENMESRQLYERAVAAARA
AGTLQWEDGARMRFV
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atggacttcgctgcctacatcagtggcctgcccggccccaagcgcggcgctctataccgc
tccccctggacctgcctagccgttttcaggaatctgccgcctctggcgcaggtctatgtg
atgcggctgctgttcgtgccgtcgcccttcccagcagactttgtggacagctgggcagcc
aagggcgcggccagcggacacaaggcagcgctgtcggcactgcgcggactggacgtcctt
acagaggagcggggcaggagcagggcaagagcgggacaaggccggggtaggagagcaaca
gggcaaggaccaaaggggcctgtggagctttcccagctcatgcgcggcgacgtgccagcc
gccgccgccagctgctgtccctccctggaggagctgggcgagtgggcggtggggcaatgg
gaggcgctgcagctgtacctgctggggagcagccgcagcccgccgcagctgccgcagctg
ctgagggtgagagcgcgcacgtgcgaggacggggcggcggcgggcaggcgcagcctggcg
gtgacgcagcgcagcttccactggctgctacagccgggggacaggcagctttgggctgtg
ctgcgcgagtacatcagcggcgcagaggcggcgtccggtgacgagctggcccacacgctg
tccttcctgttgcagctgggcttccggcgggtggggcagccctgcgcctgggcggagctg
cggccgccggagcagcgcatggcggcacacctggcgcagctgggcgtgctggcggtgttc
cagggcagcgcgggggccgccggcagcggcggcgcgctggcggctcgtggcggcggcgcg
ggcggcgcggccgctgcggcggcgatggatggcggcggcgcgggcagcgacgcctttgtc
attgtagaaagcaattaccgagtgtatgtgtacactcgctcgccagtcaccattgctgtg
ttggagctgtttgtgaagcgcgaggctctgctgcccaacctgttcgtgggggccatccgc
cgcgacagtatactggcagcgctggccaggggcatcactgcggatgagctggtggcgtac
ctgtccgcccggccccacccctccatcgccgcccgctgccccgtggtgcctgaggttgtg
tcggaccagatccggctgtgggaggcgtccatgaataggctgcaggcccaccccgcggtg
ctgtatgagaacatggagagccgccagctgtacgagcgggccgtggcggcggcgcgggcg
gccggcacactgcagtgggaggacggagcccgcatgcgcttcgtg

DBGET integrated database retrieval system