KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_138990Help
Entry
CHLREDRAFT_138990 CDS       T01039                                 

Gene name
RAE1
Definition
mRNA export protein
Orthology
K14298  
mRNA export factor
Organism
cre  Chlamydomonas reinhardtii
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:cre03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 352 aa AA seqDB search
MFGAQAQAKPAHNPNGDLEVPAPGDMDSISSLTFSPTSDFFAVTSWNNSAYVWQYNQQGQ
TFAKAQNAGTQPVLASAWKNDGSGIFLAGCDKAVRLWDLASNQAVQVAMHDAPVKAVAWC
PQMNLLITGSWDKTFRYWDTRSPTPAHTGQLPERVYAMDLREDLLVIGTADRSLHALFVN
QPQQIKTLASQLKWQTRCVAVFPDKKGFLVGSIEGRVAVSHLSEQDQKDKNFTFKCHRLE
TDIYSVNTMSFHNQYGTFVTAGSDGTYNFWDKDSKQRLKAQAKAMYPNGQPAPITCGAFD
RTGLIYGYALSYDWSKGYAEYNPTTMKPYIMLHSCKEDEVKPKPKQPTAGRK
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgtttggagcccaggcccaggcgaagcctgcgcacaacccgaatggcgatttggaggtg
ccggcgccaggcgacatggattccatcagcagcctgacgtttagcccaacgagtgacttc
tttgctgtcacgtcatggaacaacagcgcctacgtgtggcaatacaaccagcaagggcaa
acctttgccaaggcgcagaacgctggcactcagccagtgctagcgagcgcctggaagaat
gacggcagcggcattttcctggcgggctgcgacaaggcggtccggctgtgggacctggcc
agcaaccaggcggtgcaggtggcgatgcacgacgcccccgtcaaggccgtggcgtggtgc
ccgcagatgaacttgctcatcaccgggtcctgggacaagacgttccgctactgggacact
cgctcgccgacgccagcgcacacggggcagctgccggagcgggtgtacgcgatggacttg
cgggaggacctgctggtcatcggcacggcggaccgcagcctgcacgcgctgtttgtaaac
cagccgcagcagatcaagacgctcgcgtcgcagctaaaatggcagacgcgctgcgtcgcg
gtgttcccagacaaaaaggggttcctggtcggctccatcgagggccgcgtcgcggtgtcg
cacctcagcgagcaggaccagaaggacaagaacttcaccttcaagtgccaccgcctggag
accgacatctactcggtcaacaccatgtccttccacaaccagtacggcacatttgtcacc
gccggctccgacggcacctacaacttctgggacaaggactccaagcagcgcctgaaggcg
caggccaaggccatgtaccccaacggccagcccgcacccatcacctgcggcgccttcgac
cgcaccggcctcatctacggctacgcgctcagctacgactggagcaagggctacgccgag
tacaaccccaccaccatgaagccatacatcatgctgcactcgtgtaaggaggacgaggtc
aagcccaagcccaagcagcccaccgccggccgcaagtaa

DBGET integrated database retrieval system