KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_139750Help
Entry
CHLREDRAFT_139750 CDS       T01039                                 

Gene name
ACS2
Definition
acetyl CoA synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
cre  Chlamydomonas reinhardtii
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:cre01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cre00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:cre00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:cre00640]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 699 aa AA seqDB search
MQTKSFSPQQQQRRGVCGNAHAPRLSLRHAPRSSRCAPCRVAAPEAPTTVSASTLNTSFV
QDKQQYEALYKRSIEDPAGFWAEIAEQFHWETKWERDHMRYNFDVRAGPISVEWFRGATT
NIAYNCLDRHVLAGRGDQTCFIWEGNDVGREKSMTYAEALDEVCKLANWLRAAGVKKGDA
VAVYMPMLLELPLAMLACARIGAVHSVVFGGFSAESLAQRMEDCKAKVLLTASGVMRGPK
SIDLKKIADKACKLSAEAGHTVEHVLVYENDNAVPAADCPFTPGRDRWWQSEVAAQPTTC
APEWVEAEHPLFLLYTSGSTGKPKGVLHSTGGYMVYAATTMRHVFGLQQGDVYWCTADCG
WITGHSYLAYGPLLNGTTQIVFEGVPTHPTPARCWEVVAAHGVTQFYTAPTAIRSLMSFG
DQWVSQCDTSSLKLLGSVGEPINPEAWRWYHEVVGKGKCPIVDTWWQTETGGHMITPLPG
AWPEKPGSATLPFFGVRPVVLDEKGNELQGEAEGILAISQPWPSTLRTVYGDHERYQSNY
FGPFPGYYFTGDGCRRDADGYYWITGRVDDVINVSGHRIGTAEVESALVAHPACAEAAVV
GYDHPIKGQGIYAYVTLMAGVEATKELKKELVGSVRSIIGAFAAPDVIHWAPGLPKTRSG
KIMRRVLRKIASKEEDQLGDTSTLADPGVVATLVELRGK
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacaaagtctttcagccctcaacagcagcagcggcgtggggtgtgcggtaacgcc
cacgcccctcgcctgtcgcttcgccatgcaccgcggagctctcggtgcgcgccctgccgc
gttgccgcgcccgaggcgcccacgactgtcagcgcgtcgacgctgaacacgagctttgtg
caggacaagcaacagtacgaggccctctacaagcgctccattgaggacccggccggcttc
tgggccgagatcgccgagcagttccactgggagaccaagtgggagcgcgaccacatgcgc
tacaacttcgacgtgcgggccggccccatctctgtggagtggttccgcggcgccaccacc
aacatcgcctacaactgcctggacaggcacgtgcttgctggccgcggcgaccagacgtgc
ttcatctgggagggcaacgacgtgggccgcgagaagagcatgacgtacgccgaggcgctg
gacgaggtctgcaagctggccaactggctgcgggctgcgggcgtgaagaagggcgacgcg
gtggctgtgtacatgcccatgctgctggagctgccgctggccatgctggcctgcgcgcgc
atcggcgccgtgcactcggtggtgtttggcggcttcagcgcggagagcctggcgcagcgc
atggaggactgcaaggccaaggtgctgctgacggcctcgggcgtgatgcgcggccccaag
tccatcgacctgaagaagattgcggacaaggcatgcaagctgagcgccgaggccggacac
acggtggagcacgtgctggtgtacgagaacgacaacgccgtgcccgccgccgactgcccc
ttcacgcccggccgcgaccgctggtggcagtcggaggtggcggcgcagcccaccacctgc
gcgccggagtgggtggaggcggagcacccgctgttcctgctgtacacctcggggtccacg
ggcaagcccaagggcgtgctgcacagcacgggcggctacatggtgtacgccgccaccacc
atgcggcacgtgttcgggctgcagcagggcgacgtgtactggtgcacagccgactgcggc
tggatcaccggccactcctacctggcgtacggccccctgctcaacggcaccacacagatt
gtgtttgagggcgtgcccacgcaccccacgcccgcccgctgctgggaggtggtggcggcg
cacggcgtgacgcagttctacacggcgcccaccgccatccgctcgctcatgtcgtttggc
gaccagtgggtgtcgcagtgcgacaccagcagcctcaagctgctgggctccgtgggcgag
cccatcaaccccgaggcctggcgctggtaccacgaggtggtgggcaagggcaagtgcccc
atcgtggacacctggtggcagacggagacgggcggacacatgatcacgccgctgccgggc
gcctggcccgagaagcccggcagcgccacgctgcccttcttcggcgtgcggccagtggtg
ctggacgagaagggcaacgagttgcagggcgaggcggagggcatcctggccatctcccag
ccctggccctccacgttgcgcaccgtgtacggcgaccacgagcgctaccagtccaactac
ttcggccccttccccggctactacttcaccggcgacggctgccggcgcgacgcggacggc
tactactggatcacgggccgggtggacgacgtgatcaacgtgagcgggcaccgcatcggc
acggcggaggtggagagcgcgctggtggcgcaccccgcctgcgcggaggcggcggtggtg
ggctacgaccaccccatcaaggggcagggcatctacgcctacgtcaccctcatggctggc
gtcgaggcgaccaaggagctgaagaaggagcttgtgggcagcgtgcgctccatcatcggc
gccttcgccgcgcccgacgtcatccactgggctccggggctgcccaagacgcgcagcggc
aagatcatgcggcgcgtgctgcgcaagatcgcgagcaaggaggaggaccagctgggcgac
accagcacactggcggacccgggcgtggtggccacactggtggagctgcgcggcaagtag

DBGET integrated database retrieval system