KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_139750Help
Entry
CHLREDRAFT_139750 CDS       T01039                                 

Gene name
ACS2
Definition
acetyl CoA synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
cre  Chlamydomonas reinhardtii
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cre00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CHLREDRAFT_139750 (ACS2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CHLREDRAFT_139750 (ACS2)
   00620 Pyruvate metabolism
    CHLREDRAFT_139750 (ACS2)
   00640 Propanoate metabolism
    CHLREDRAFT_139750 (ACS2)
Enzymes [BR:cre01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     CHLREDRAFT_139750 (ACS2)
Lipid biosynthesis proteins [BR:cre01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   CHLREDRAFT_139750 (ACS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 699 aa AA seqDB search
MQTKSFSPQQQQRRGVCGNAHAPRLSLRHAPRSSRCAPCRVAAPEAPTTVSASTLNTSFV
QDKQQYEALYKRSIEDPAGFWAEIAEQFHWETKWERDHMRYNFDVRAGPISVEWFRGATT
NIAYNCLDRHVLAGRGDQTCFIWEGNDVGREKSMTYAEALDEVCKLANWLRAAGVKKGDA
VAVYMPMLLELPLAMLACARIGAVHSVVFGGFSAESLAQRMEDCKAKVLLTASGVMRGPK
SIDLKKIADKACKLSAEAGHTVEHVLVYENDNAVPAADCPFTPGRDRWWQSEVAAQPTTC
APEWVEAEHPLFLLYTSGSTGKPKGVLHSTGGYMVYAATTMRHVFGLQQGDVYWCTADCG
WITGHSYLAYGPLLNGTTQIVFEGVPTHPTPARCWEVVAAHGVTQFYTAPTAIRSLMSFG
DQWVSQCDTSSLKLLGSVGEPINPEAWRWYHEVVGKGKCPIVDTWWQTETGGHMITPLPG
AWPEKPGSATLPFFGVRPVVLDEKGNELQGEAEGILAISQPWPSTLRTVYGDHERYQSNY
FGPFPGYYFTGDGCRRDADGYYWITGRVDDVINVSGHRIGTAEVESALVAHPACAEAAVV
GYDHPIKGQGIYAYVTLMAGVEATKELKKELVGSVRSIIGAFAAPDVIHWAPGLPKTRSG
KIMRRVLRKIASKEEDQLGDTSTLADPGVVATLVELRGK
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacaaagtctttcagccctcaacagcagcagcggcgtggggtgtgcggtaacgcc
cacgcccctcgcctgtcgcttcgccatgcaccgcggagctctcggtgcgcgccctgccgc
gttgccgcgcccgaggcgcccacgactgtcagcgcgtcgacgctgaacacgagctttgtg
caggacaagcaacagtacgaggccctctacaagcgctccattgaggacccggccggcttc
tgggccgagatcgccgagcagttccactgggagaccaagtgggagcgcgaccacatgcgc
tacaacttcgacgtgcgggccggccccatctctgtggagtggttccgcggcgccaccacc
aacatcgcctacaactgcctggacaggcacgtgcttgctggccgcggcgaccagacgtgc
ttcatctgggagggcaacgacgtgggccgcgagaagagcatgacgtacgccgaggcgctg
gacgaggtctgcaagctggccaactggctgcgggctgcgggcgtgaagaagggcgacgcg
gtggctgtgtacatgcccatgctgctggagctgccgctggccatgctggcctgcgcgcgc
atcggcgccgtgcactcggtggtgtttggcggcttcagcgcggagagcctggcgcagcgc
atggaggactgcaaggccaaggtgctgctgacggcctcgggcgtgatgcgcggccccaag
tccatcgacctgaagaagattgcggacaaggcatgcaagctgagcgccgaggccggacac
acggtggagcacgtgctggtgtacgagaacgacaacgccgtgcccgccgccgactgcccc
ttcacgcccggccgcgaccgctggtggcagtcggaggtggcggcgcagcccaccacctgc
gcgccggagtgggtggaggcggagcacccgctgttcctgctgtacacctcggggtccacg
ggcaagcccaagggcgtgctgcacagcacgggcggctacatggtgtacgccgccaccacc
atgcggcacgtgttcgggctgcagcagggcgacgtgtactggtgcacagccgactgcggc
tggatcaccggccactcctacctggcgtacggccccctgctcaacggcaccacacagatt
gtgtttgagggcgtgcccacgcaccccacgcccgcccgctgctgggaggtggtggcggcg
cacggcgtgacgcagttctacacggcgcccaccgccatccgctcgctcatgtcgtttggc
gaccagtgggtgtcgcagtgcgacaccagcagcctcaagctgctgggctccgtgggcgag
cccatcaaccccgaggcctggcgctggtaccacgaggtggtgggcaagggcaagtgcccc
atcgtggacacctggtggcagacggagacgggcggacacatgatcacgccgctgccgggc
gcctggcccgagaagcccggcagcgccacgctgcccttcttcggcgtgcggccagtggtg
ctggacgagaagggcaacgagttgcagggcgaggcggagggcatcctggccatctcccag
ccctggccctccacgttgcgcaccgtgtacggcgaccacgagcgctaccagtccaactac
ttcggccccttccccggctactacttcaccggcgacggctgccggcgcgacgcggacggc
tactactggatcacgggccgggtggacgacgtgatcaacgtgagcgggcaccgcatcggc
acggcggaggtggagagcgcgctggtggcgcaccccgcctgcgcggaggcggcggtggtg
ggctacgaccaccccatcaaggggcagggcatctacgcctacgtcaccctcatggctggc
gtcgaggcgaccaaggagctgaagaaggagcttgtgggcagcgtgcgctccatcatcggc
gccttcgccgcgcccgacgtcatccactgggctccggggctgcccaagacgcgcagcggc
aagatcatgcggcgcgtgctgcgcaagatcgcgagcaaggaggaggaccagctgggcgac
accagcacactggcggacccgggcgtggtggccacactggtggagctgcgcggcaagtag

DBGET integrated database retrieval system