KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_140252Help
Entry
CHLREDRAFT_140252 CDS       T01039                                 

Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
cre  Chlamydomonas reinhardtii
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cre00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CHLREDRAFT_140252
Enzymes [BR:cre01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     CHLREDRAFT_140252
Peptidases [BR:cre01002]
 Cysteine Peptidases
  Family C44
   CHLREDRAFT_140252
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 578 aa AA seqDB search
MCGILAVLNTTDDSQAMRSRVLALSRRQRHRGPDWSGMHQFGNNFLAHERLAIMDPASGD
QPLFNEDRTIVVTVNGEIYNYKELRQQITDACPGKKFATNSDCEVISHLYELHGEKVASM
LDGFFAFVVLDTRNNTFYAARDPIGITCMYIGWGRDGSVWLSSEMKCLKDDCTRFQQFPP
GHFYNSKTGEFTRYYNPKYFLDFEAKPQRFPSAPYDPVALRQAFEQSVEKRMMSDVPFGV
LLSGGLDSSLVASIAARKIKREGSVWGKLHSFCVGLPGSPDLKAGAQVAEFLGTDHHEFH
FTVQEGIDAISEVIYHIETFDVTTIRASTPMFLMSRKIKALGVKMVLSGEGSDEVFGGYL
YFHKAPNKEEFQSETVRKIQDLYKYDCLRANKSTMAWGVEARVPFLDRHFLDVAMEIDPA
EKMIDKSKGRIEKYILRKAFDTPEDPYLPNEVLWRQKEQFSDGVGYNWIDGLKAHADSQV
SDDMMKTAAHRYPDNTPRTKEAYWYRSIFETHFPQRAAVETVPGGPSVACSTATAALWDA
TWAGKEDPSGRAVAGVHDSAYDAAAAANGEPAAKKAKK
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcattcttgccgtcctcaacacgacggatgacagccaggctatgcgctcgagg
gtgctggccctgagccgtcgccagcgtcaccgtggccccgactggtctggcatgcaccag
ttcggcaacaacttccttgcccatgagcgccttgcgattatggaccccgcctcgggtgac
cagcccctgttcaacgaggaccgcacaatcgtggtcaccgtgaacggtgagatctacaac
tacaaggagctgcgccagcagatcacggatgcctgccccggcaagaagttcgccaccaac
agcgattgcgaggtgattagccacctgtacgagctgcacggcgagaaggtggcctccatg
ctggacggcttcttcgccttcgtggtgctggacacccgcaacaacaccttctacgccgcg
cgcgaccccattggcatcacctgcatgtacatcggctggggccgtgacggcagcgtgtgg
ctgtcgagcgagatgaagtgcctgaaggatgactgcacccgcttccagcagttccctccc
gggcacttctacaactccaagacgggtgagttcacccgctactacaaccccaagtacttc
ctggacttcgaggccaagccgcagcgtttccccagcgctccctacgaccccgtcgcgctg
cgtcaggcgttcgagcagtccgtggagaagcgcatgatgtcggatgtgccgttcggcgtg
ctgctgtcgggcggcctggacagctcgctggtggcgtccatcgcggcgcgcaagattaag
cgtgagggcagcgtgtggggcaagctgcacagcttctgcgtgggcctgcccggcagccct
gacctgaaggctggcgcccaggtggctgagttcctgggcaccgaccaccacgagttccac
ttcacggtgcaggagggcattgacgccatcagcgaggtcatctaccacattgagaccttt
gacgtcaccaccatccgcgcctccacgcccatgttcctgatgagccgcaagatcaaggcg
ctgggcgtgaagatggtgctgtcaggcgagggttccgacgaggtgttcggcggctacctg
tacttccacaaggcgcccaacaaggaggagttccagtcggagactgtgcgcaagatccag
gacctgtacaagtacgactgcctgcgcgccaacaagtccaccatggcttggggcgtggag
gcgcgcgtgccgttcctggaccgccacttcctggacgtggccatggagatcgaccccgcc
gagaagatgattgacaagagcaagggccgcatcgagaagtacatcctccggaaagccttc
gatacccccgaggacccctacctgcccaacgaggtgctctggcgccagaaggagcagttc
agcgacggcgtgggctacaactggatcgacggcctcaaggcgcacgcggacagccaggtc
agcgacgacatgatgaagacggccgcgcatcggtaccccgacaacacgccccgcaccaag
gaggcgtactggtaccgcagcatcttcgagacccacttcccccagcgtgccgccgtggag
acggtgccgggcggcccctcggtggcctgctccaccgccaccgccgcgctgtgggacgcc
acctgggctggcaaggaggacccctcgggccgcgccgtggccggcgtgcacgactcggcc
tacgacgccgccgccgccgccaacggcgagccggctgccaagaaggccaagaagtaa

DBGET integrated database retrieval system