KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_140452Help
Entry
CHLREDRAFT_140452 CDS       T01039                                 

Gene name
STA11
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
cre  Chlamydomonas reinhardtii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cre00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 584 aa AA seqDB search
MIPLRAPQGVRYTQQIDRSQQVLPQLRSRAPQSVSHVAGSRRAVSRRSVRAFAWGTPKTT
GPAPGEVLGKDYDQKIPSYNKGRRAGILLHPTSLPGPYGIGDIGDEAKRFVDWLADHGMQ
CWQLLPLVPPDPMYYSPYSGTDANCGNPLVVSIEELIKDGLLEFSETPPRVPIADVDYPA
VAAAKLPLLKRAAQRLLKEDRFTRLREEYLKYRKEHPWVEDSALFDVARNLPELSQLAWW
QWPEPLRLRQKEALKEFRETNKDAIDEFVVIQYFFEKQWKAIRSYANGKGIKLIGDMPIY
VGGHSADVWANRHLFELNEAGLPEQVSGVPPDAFSATGQLWGSPLYKWPAHKKEGFKWWT
ARMARTLELYDECRIDHFRGFAGYWSVDANETTAMNGNWRQGPGLELFTAMKKALGAVPI
LAEDLGVITTDVVALREAIGAPGMVVLQFAWGGGPGNVHLPHNHYENCFVYPGTHDNETA
VGWFRGSANDTDKSYIKSYLRTDGGDIAWDFIRACMAAVPRTCVIMMQDVMRLDNTARMN
TPGTAAGNWRWRMGDGNVWNSLKKEGEDLRKVAHDTNRLPKPKA
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgatcccacttcgtgcgccacaaggcgttaggtatacgcaacaaatagatcgaagccag
caggtgctcccgcagcttcgctcgcgtgctccgcaatcggtatcgcacgtcgccggctcg
cggcgcgctgtcagcaggcggtctgtccgcgccttcgcttggggaactccaaaaacgacg
ggcccggcgccaggcgaagtgctcggcaaggattatgaccagaaaatccccagctataat
aaggggcgccgcgcgggcattctgctgcaccccacctctctcccggggccgtacggcatt
ggcgatattggtgatgaggccaagcgcttcgtcgactggctcgccgaccacggcatgcag
tgctggcagctgctgccgctggtgcccccggaccccatgtactactccccctactcgggc
acggacgccaactgcggcaacccccttgtggtgagcattgaggagctcatcaaggacgga
ctgctggagttctcggagacgcccccgcgcgtgcccatcgccgacgttgactatcccgct
gtggccgcggccaagctgcccctgctcaagcgcgcggcgcagcggctgcttaaggaggac
cgcttcacgcggctgcgggaggaatacctcaagtaccgcaaagagcacccctgggtggag
gacagcgcgctgtttgatgtggcgcgcaacctgccggagctgagccagttggcgtggtgg
cagtggccggagccgttgcggctgcggcagaaggaggcgctcaaggagttccgggagaca
aacaaggacgcaattgacgagttcgttgtgatccagtacttcttcgagaagcagtggaag
gcgatccggtcctacgcgaacggcaagggcatcaaactcatcggcgacatgcccatctac
gtgggcggccacagcgcagatgtgtgggccaaccgccacctgttcgagctgaacgaggcg
ggcctgcccgagcaggtcagcggagtgccgccggacgccttctcagcaacgggccagctg
tggggcagcccgctttacaagtggccggcccacaagaaggagggcttcaagtggtggacg
gcgcgcatggcccggaccctggagctgtacgacgagtgccgcatcgaccacttccgtggc
ttcgcaggctactggagcgtggacgccaacgagaccaccgccatgaacggcaactggcgc
cagggccctgggctggagctgttcacggccatgaagaaggcgctgggggcggtgcccatc
ctggctgaggacctgggcgtcatcaccacggacgtggtggcgctgcgcgaggccatcggc
gctccgggcatggtggtgctgcagttcgcctggggcggcggccccggcaatgtgcacctg
ccgcacaaccactacgagaactgcttcgtgtacccgggcacccacgacaacgagacggcg
gtgggctggttccgcggctccgccaacgacacggacaagtcctacatcaagagctacctg
cgcacggacggcggcgacatcgcctgggacttcatccgcgcctgcatggcggcggtgcca
cgcacgtgcgtcatcatgatgcaggacgtgatgcggctggacaacacggctcgcatgaac
acgcccggcacggccgccgggaactggcgttggcgcatgggcgatggcaacgtgtggaac
tcgctcaagaaggagggcgaggacctgcggaaggtggcacacgacacgaaccgcctgccc
aagcccaaggcgtga

DBGET integrated database retrieval system