KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_142126Help
Entry
CHLREDRAFT_142126 CDS       T01039                                 

Definition
phospholipase C (EC:3.1.4.11)
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
cre  Chlamydomonas reinhardtii
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:cre00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    CHLREDRAFT_142126
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    CHLREDRAFT_142126
Enzymes [BR:cre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     CHLREDRAFT_142126
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 495 aa AA seqDB search
MGNVFSCFETGPWDPHPEINTSYTPARTDVYQDMKQPLSHYFVSSGHNSYLTGNQLTSAS
GTATIIACLQGSCRVIELDVYNGPECKHGGTLTKAISFKECIEAIGEYAFKASPYPVIIT
MENHANTENQGLMAQILREVLGDKLFVPHPDDPMEAWKSPEELKHKVVCRTSLKPNAHEE
FKKLIYIKNSKFTGLAEMIKKGGVVVLRGDVKELGADDADEERETQREMEKLQAQQAKAK
AAGHEGNSADETPEDAVVGGGMVTGSIQELYTYTGKHLMRVYPAGWRITSGNYNPMTAWI
RGASFAALNWQVWDKPLWCNAGKFLDNGRSGYVLKPDWMRNPPSELPARPGRKLLVHVYS
AHMHQGKNVSVFKDDLFVKMEVYGMPTDRESKYTKTVNNSGRLLVNEEYDFVVRFPEMAV
LCVQLMDEDAGGAKTNHADADTLGYYTLPLSTLKEGTYKLQLNHPDSGKALPVDEAWVKV
SFKWAAENPMYAGPK
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacgtgttcagctgcttcgagactgggccctgggacccgcatcctgaaattaac
acttcatacacgcccgcgaggacggacgtgtatcaagacatgaagcagccgctttcgcac
tactttgtgtcttctgggcacaactcatacctcacaggcaaccagctcacgtcggcgtcc
ggcacggcgacgatcattgcgtgcctgcaagggtcgtgccgcgttatcgagcttgacgta
tacaacgggccggagtgcaagcacggcggcacactcaccaaggctatcagcttcaaggag
tgcatcgaggcgatcggcgagtacgcgttcaaggcgtcgccctacccggtgatcattacc
atggagaaccacgccaacacggagaaccagggtctgatggcccagatcctgcgcgaggtg
ctgggcgacaagctgttcgtgccccacccggacgaccccatggaagcctggaagagcccc
gaggagctcaagcacaaggtcgtgtgccgcacctcgctcaagcccaacgcgcacgaggag
ttcaagaagctcatttacatcaagaactcgaagttcacgggcctggcggagatgatcaag
aagggtggtgtcgtcgtccttcgaggagatgtcaaggagctgggcgcggacgatgcggac
gaggagcgggagacgcagcgggagatggagaagctgcaggcgcagcaggccaaggccaag
gcggcggggcatgaggggaacagcgctgatgagacgccggaggacgcagtggtcgggggc
gggatggtcacggggtcgatacaggagctgtacacgtacacgggcaaacaccttatgcgt
gtgtacccggccggctggcgcatcacgtcgggcaactacaaccccatgaccgcctggatc
cgcggcgcctccttcgccgcgctgaactggcaggtctgggacaagccgctgtggtgcaac
gccggcaagttcctggataacgggcgcagcggctacgtgctgaagccggactggatgcgc
aacccgcccagcgagctgccggcgcggccgggtcgcaagctgctggtgcacgtgtacagc
gcgcacatgcaccagggcaagaacgtgtccgtgttcaaggatgacctgttcgtcaagatg
gaggtctacggaatgcccaccgaccgcgagagcaagtacacgaaaaccgtgaacaacagc
gggcgcctgctcgtgaacgaggagtacgacttcgtggtgcgcttccccgagatggcggtg
ctgtgcgtgcagctcatggacgaggacgcaggtggcgccaagactaaccacgcggacgcg
gacacgctgggatactacaccctgccgctgtccacactcaaggagggcacctacaagctg
cagctgaaccaccctgacagcggcaaggcgctgccggtggacgaggcctgggtcaaggtc
agcttcaagtgggcggctgagaaccccatgtacgccgggcccaagtag

DBGET integrated database retrieval system