KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_142398Help
Entry
CHLREDRAFT_142398 CDS       T01039                                 

Definition
histone acetyltransferase
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
cre  Chlamydomonas reinhardtii
Brite
Enzymes [BR:cre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CHLREDRAFT_142398
Transcription machinery [BR:cre03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     CHLREDRAFT_142398
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 517 aa AA seqDB search
MSDEAPPTKRQCIEQVQSHAGPIDANGEVKVEPRSDAAVAAQQAAQAKERSAASQLVQEP
AGPGPSSSSARDRPYIAPGAYSQREEALIKREQDGDIAFRYVFNNDDPQNLIYLVGLKNI
FSKQLPNMPKEYIVRLVFDRRHRSVALLKRNGTVIGGITYRAFHEQAFGEIAFCAVTSHE
QVKGYGTRLMNQTKEFARTVDRLTHFLTYADNNAVGYFEKQGFTREITLARERWQGYIKD
YDGGTLMECVMHPRVSYTALPDLIRTQRLALDDRVRQVSNSHVVRTGLRHFQEEDARLAA
ATAAAAAAAGAAGGRGAGGVGAGAPAGDAAAATADTDPALRRRMLDIGGIPGVREAGWSP
DMVQQGPRFRLLLDEAGAGPAVEAGSEALHRFLVLLLEHVKGLEDAWPFRERVAVQDAPD
YYDIIKDPMALDVMEERLASRGYYVTLDIFTADLRRVFDNCRLYNAPDTIYYKLANKLEA
QVNAFMSNHVLYEDEAGPAAAAAAAAAGTGAGAGAGR
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgaagcaccacctaccaaacgacaatgtattgagcaagttcaaagccacgca
gggcctatagacgcgaacggcgaagtcaaggttgaaccgcgcagcgacgcggcagtagct
gcgcagcaggcagcgcaagcaaaagaacgttcagcagcgagccaactggtgcaggaaccc
gcggggccagggccgagctcttcctcagcgcgggaccggccctacatcgctccgggcgcc
tactcgcagcgcgaggaggcccttataaagcgcgaacaggatggagacatcgcattccgc
tacgtattcaacaacgacgacccgcagaacctcatttacttggtggggctgaagaacatt
ttctcaaagcagctgccaaacatgcccaaggagtacatcgtgcgcctggtgtttgaccgg
cggcaccgctccgtggcgctgctgaagcgcaacggcaccgtcatcggcggcatcacctac
cgcgccttccacgagcaggcattcggcgagatcgccttctgcgccgtgaccagccacgag
caggtcaagggctacggcacgcggctcatgaaccagaccaaggagttcgcgcgcaccgtg
gaccgcctcacgcacttcctcacctacgccgacaacaacgcggtggggtactttgagaag
cagggcttcacgcgcgagatcacgctggcgcgggagcgctggcagggctacatcaaggac
tacgacggcggcacgctgatggagtgcgtcatgcacccgcgcgtcagctacaccgccctg
cccgacctcatccgcacgcagcgcctggcgctggacgaccgcgttcgccaggtctccaac
tcccacgtggtgcggaccgggctgaggcacttccaggaggaggacgcgcggctggcggcg
gccacggcagcagcagcggcggcggcgggggcagcaggagggagaggcgcgggcggtgta
ggggccggggcgccggctggtgacgcggcggcggcaacagcggacaccgacccggcgttg
cggcgacgtatgctggacatcggcggcatcccaggggtgcgggaggcgggctggtcgccg
gacatggtgcagcaggggccgcgcttccggctgctgctggacgaggcgggggcgggtccg
gcggtggaggcggggtcggaggcgctgcaccggttcctggtgctgctgctggagcacgtc
aaggggctggaggacgcctggccgttccgggagcgggtggcggtgcaggacgcgcccgac
tactacgacatcatcaaggaccccatggctctggacgtgatggaggagcgcctggcctcg
cgcggctactacgtcaccctggacatcttcaccgccgacctgcgccgcgtgttcgacaac
tgccgcctctacaacgcgccggacaccatctactacaagctggccaacaagctggaggcg
caggtcaacgccttcatgtccaaccacgtgctgtacgaggatgaggcagggccggcggcg
gcggcagcggcagcggcagctgggactggggctggagcaggcgctgggcggtag

DBGET integrated database retrieval system