KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_142512Help
Entry
CHLREDRAFT_142512 CDS       T01039                                 

Gene name
PDK3
Definition
mitochondrial pyruvate dehydrogenase kinase
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
cre  Chlamydomonas reinhardtii
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 401 aa AA seqDB search
MLASLAPQWSAGFGFAARAFAKTAASAARQGAIGSVRLIDSFHKETVDDIFAHALKKQTG
VSLKYMLDFGQNPIERQLLLSAQFLHKELPVRLAHRVAELENLPYGLSAKKHILQVRDWY
VESFRDLRSFPHVKDAADELKFTELLRGIYRRHANAVPVMAKGVSELREELRLQQRLTEL
PEIHQFLDGFYLSRIGIRILIGQHIALHEPSKPNHIGLICTKCSPVLVAQDAINDARSIC
MREYGDAPEVSVYGSPDFVFPYVPSHLHHMLFELVKNSLRAVQDRFADSDDAAPPIRLVV
AEGGEDVTLKVSDEGGGIPRSGLANIWTYLYSTAKSPVDPRQVEDVDSGPVVLAGYGYGL
PISRLYARYFGGDLQIISMEGYGTDAYLHLNRLGTSQEPLP
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgttggcaagccttgcgcctcagtggagcgctggtttcggcttcgcagctcgggcgttc
gctaaaacagctgcatccgcggcaagacagggagccatcggctctgtcaggcttatcgac
tcctttcacaaagagacggtggacgacatcttcgcgcatgcgcttaagaagcagactggc
gttagccttaaatacatgctcgactttgggcaaaatccgattgagcggcagctgctgctg
tcggcacagttcctgcacaaggagctgccggtgcggctagcgcaccgcgtggcggagctg
gagaacctgccgtatgggctcagcgccaagaagcacatactgcaggtgcgggactggtac
gtagagtcgttccgggacctgcgctccttcccgcacgtcaaggacgctgcggacgagctc
aagttcacagagctgctcaggggcatctaccgcaggcacgccaacgcggtgccagtcatg
gccaagggcgtcagcgagctgcgcgaggagctgcggttgcagcaacggctgacggagctg
cctgagatccaccagttcctggacggcttctatctcagccgcattggcatccgcatcctc
atcggccagcacattgcgctgcatgagccgtccaagcccaaccacatcggcctcatctgc
accaagtgcagtccggtgctagtggcgcaggacgccatcaacgacgcacgcagcatctgc
atgcgcgagtacggagacgcgcccgaggtgtctgtttacggcagcccggactttgtgttc
ccttacgtgcccagccacctgcaccacatgctgtttgagctggtcaagaacagtttgagg
gcggtgcaggaccggttcgcagacagcgacgacgcagcgccgcccattaggctggttgtg
gcggagggcggtgaggacgtgacgttgaaggtgtcagacgaaggaggcggcattccgcgc
tcgggcctggccaacatctggacctacctctactccacagccaaaagccctgtggacccg
cgtcaggttgaggacgttgacagcggcccggtggtgctggcgggctacggctacggcctg
cccatcagccgcctgtacgccaggtactttggcggcgacctgcaaatcatctccatggag
ggctacggcactgacgcctacctgcacctcaaccgcctgggcaccagccaggagccgctg
ccctag

DBGET integrated database retrieval system