KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_142797Help
Entry
CHLREDRAFT_142797 CDS       T01039                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
cre  Chlamydomonas reinhardtii
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cre00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CHLREDRAFT_142797
Enzymes [BR:cre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     CHLREDRAFT_142797
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 339 aa AA seqDB search
MSEGNIFRPLGMGAYTLNGGGPGRDIDLVLLDERWYRDPLPCSVRRAWCEGVLAQPDHNA
LGWCRDFLLDDGATGRGSCCTKDDDLAAWCGLPSSRSSPLWAAACDPTSSAWASEPLVLG
PDNATLLAVDPGLYDSALRELWPRLLQAETSPVCEMLGSAQRQWLSRRLAASTAALTLVA
SGSVMLGSVGYNDPVLGYCSGDDWNCYQPAQLNLLHTLANTSRGCVVVLTGDFHYGDIKT
GKIKKHIYQLMSSGMSSSTAVHDGAPCTGSYREDTVGLRPLGKCSYMQQPNFGMVEVDWD
KQVVHLTVRAASGGGIATGSDGKPQHLAFSLQTCAPLPA
NT seq 1019 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaggggaacatattcagacccctcggcatgggcgcctacacgctcaacggcggc
ggcccgggtcgcgacattgacctggtcctactggatgagcgctggtaccgagaccccctg
ccctgcagcgtgcgccgggcctggtgcgagggcgtgctggcccagcccgaccacaacgcg
ctgggctggtgccgcgacttcctgctggacgacggcgccacgggccgcggctcctgctgc
accaaggacgacgacctggcggcctggtgcggactgccctcctcccgctccagccctctg
tgggccgccgcctgcgaccccacctcatccgcctgggcctcggagccgctggtgctgggg
cccgacaacgccacactgctggcggtggaccccggactgtacgacagcgcactgagggag
ctgtggccgcgactgctgcaggcggagacgtcgccggtgtgcgagatgctgggctccgcg
cagcggcagtggctgtctcggcggctggccgccagcaccgccgccctgacgctggtggcc
agcggcagtgtgatgctgggcagtgtgggatacaacgacccagtgctgggctactgctcc
ggagacgactggaactgctaccagcccgcgcagctcaacctgctgcacacgctggccaac
acctcccgcggctgtgtggtggtgctcacaggcgacttccattacggagacatcaagacc
gggaagattaagaagcacatatatcagctcatgagtagcggcatgagcagcagcacggcg
gtgcacgacggcgcgccctgcacggggtcctaccgcgaggacacggtggggctgcggccg
ctgggcaagtgctcctacatgcagcagcccaacttcggcatggtcgaggtggactgggac
aaacaggtggtgcacctcacggtgcgggccgcgagcggcggcggcatcgccaccggctca
gacggcaagccgcagcacctggcgttctcgttgcagacctgcgccccactgccggcgtg

DBGET integrated database retrieval system