KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_143033Help
Entry
CHLREDRAFT_143033 CDS       T01039                                 

Definition
hypothetical protein
Organism
cre  Chlamydomonas reinhardtii
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 254 aa AA seqDB search
MSLWDGVRRRDAAEEAAGVKAKAAKQIADAAAAAADAAAADAAATGAPHIAPGAFSNEPP
LYDVFLSHKRTDARDFARALWNLLVSNGYTVFLDFEFKQELGSLEEMVGRCTHFLFIMTD
NVFKSEWCIKELVAAVKHNVNIVLMIKDGARWADVDGNPTCDFPPPHLLRTLPAEVQHVF
SKKPVVHNDEYYRAFVEALFDKAELAAVRRDLAAEVAGLGRSLISGQQELRSGLGGEVAA
AARLVWSWVTFGRS
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgtccttatgggatggcgtacgaagaagagatgctgccgaggaggcggccggcgttaag
gccaaggccgcgaagcagattgctgacgctgcggccgcggccgccgacgccgcggcggcg
gacgccgccgccaccggcgcgcctcacattgcgcccggcgccttctccaatgagccgccg
ctctacgacgtcttcctcagccacaagcgcactgacgcgcgcgactttgctcgcgcgctg
tggaacctgctcgtcagcaacggctataccgttttcctggactttgagtttaagcaggag
ctggggtcgctggaggagatggtgggtcgctgcacgcactttctgttcatcatgacggac
aacgtgttcaagagcgagtggtgcatcaaggagctcgtggctgccgtgaagcacaacgtg
aacattgtgttgatgatcaaggacggcgcgcgctgggccgacgtggacggcaaccccacc
tgcgacttcccgccgccgcacctgctgcgcacgctgccggcggaggtgcagcacgtgttc
agcaagaagccggtggtgcacaatgacgagtactatcgcgcctttgtggaggcgctgttt
gacaaggccgagctggcggccgtgcgtcgtgacctggcagcggaggtggcgggtctgggt
cgcagcctgatcagcgggcagcaggaactccgcagcgggctgggcggcgaggtggcggcg
gcggcgcggctggtgtggagctgggtgacgttcggcaggagctag

DBGET integrated database retrieval system