KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_143122Help
Entry
CHLREDRAFT_143122 CDS       T01039                                 

Gene name
GPX5
Definition
(RefSeq) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
cre  Chlamydomonas reinhardtii
Pathway
cre00480  Glutathione metabolism
cre00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:cre00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    CHLREDRAFT_143122 (GPX5)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CHLREDRAFT_143122 (GPX5)
Enzymes [BR:cre01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     CHLREDRAFT_143122 (GPX5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 5723945
NCBI-ProteinID: XP_001698575
JGI: 143122
UniProt: O22448
Position
Unknown
AA seq 162 aa AA seqDB search
MANPEFYGLSTTTLSGQPFPFKDLEGKAVLIVNVASKCGFTPQYKGLEELYQQYKDRGLV
ILGFPCNQFGGQEPGDASAIGEFCQRNFGVTFPIMEKSDVNGNDANPVFKYLKSQKKQFM
MEMIKWNFEKFLVDKSGQVVARFSSMATPASLAPEIEKVLNA
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaccccgagttttacggcctgtcgacgaccacgctttcgggacagccctttcct
ttcaaggaccttgagggcaaggcagtcctaatcgtgaacgtggctagcaagtgcggcttt
acgccacaatacaagggtctggaggagctgtaccaacagtacaaggaccgggggctcgtc
atccttggcttcccctgcaaccagtttggaggccaggagcctggggacgctagcgccatc
ggggagttctgccagcgcaatttcggcgttacgttccccattatggagaagtcggacgtg
aacggcaacgacgccaaccccgtgttcaagtacctgaagagccaaaagaagcagttcatg
atggagatgattaaatggaactttgagaagttcctggtggacaagagcggccaggtggtg
gcgcgcttcagcagcatggctacccccgccagcctggcgccggagattgagaaggtgctg
aacgcgtaa

DBGET integrated database retrieval system