KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_145450Help
Entry
CHLREDRAFT_145450 CDS       T01039                                 

Definition
SWI/SNF chromatin remodeling complex component
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
cre  Chlamydomonas reinhardtii
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cre00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CHLREDRAFT_145450
Enzymes [BR:cre01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     CHLREDRAFT_145450
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 845 aa AA seqDB search
MVTFEDGTAVLYDQDSKVITKGRYKAFGKASASDLTFELGNWHAEMDKQLSVEDFRSGAC
FVSNTCSTSAAAAAAAPAPRKPALSSFKPHVPVGGGTVAGRPAGAGGPSGSGRAAAAAGV
LPTGLHDPHAPGAVVLNTVQWKGGSGKLRDGRPVTPVTVDPYLGRLLRPHQAEGVRFMYE
AVMGLRTADKTGCILADEMGLGKTLQVITLAWTLLRQGPEGRPVAGKVLVVTPATLVDNW
GREVKKWLGSERLQALCLQQSPTAKQQILEFRHGVHQKMMITSYETLRKHAKDLAGVFDL
LVCDEGHRLKSVGGNKTIDALLSLGCQRRVLLTGTPVQNDLQEFYALLSFVAPEALGSAA
LFNRVYGIPITRSQEGTATAEDKELGAARSSELKAKVSAFILRRTQALLAKHLPPLASLT
LFCRPTEQQVSLYTAVLRSKAVASLLGGGGGGGEDNTLAVITALRKARTQCKMQVLSELL
RGIGAVGERCVVVSTSTAALDLVGRLSTVRIDGATSVDGRQIIVDNFNKLNMGQVFLLST
RAGGAGLNLVGANHLVLYDSDWNPAMDQQAMARIWRDGQTKPCHVYRMLTTGTIEEKVYQ
RQLMKADLASATMVGGGAGGGGKSGGGKFTREELRALFSLNTATASDTRDLLPPGRVAGL
RWLEPEEFAAPADSPLAVAVATGLVTCINQMAAHSLEPEEAVAAAPGCEGAAGGAAAGSG
SGAQPMGAEESLQREGAGVGKPARAARRARAQAQAVVESEDSMDGDFEDGKGAQESEEEV
DVEEEAVEEAPAPAPPSQRRRLLQSQGAGQAGQQEEEVVVAAAAGADSGLPAAHDNPDEL
NLEDW
NT seq 2538 nt NT seq  +upstreamnt  +downstreamnt
atggtgacattcgaggatggcaccgccgtcctgtatgaccaggacagcaaggtgatcacc
aaaggccgctacaaggcctttggaaaggcctcggcgtcagacctgacctttgagctgggc
aactggcacgctgagatggacaagcaattgtccgtggaggacttcaggagcggcgcatgc
ttcgtcagcaacacctgttccaccagcgcggcggcggcagcagcagctcctgccccgcgc
aagcccgccctaagcagcttcaagccgcacgtgccggtgggaggcggtactgtcgccggg
cggcctgcaggagccggcggcccatctgggtcgggccgtgcggcggcggcagcgggcgtg
ctgcccaccggcctgcacgacccacatgcgcccggcgccgtggtgctgaacactgtgcag
tggaagggcggcagcggcaagctgcgcgacgggcgccccgttacacctgtcacggttgac
ccctacctgggccggctgctgcggccgcaccaggcggagggcgtgcgcttcatgtacgag
gcggtgatggggctgcgcacagccgacaagaccggatgcatcctggccgacgagatgggg
ctgggcaagacgctgcaggtcatcacgctagcgtggacgctgctgcggcagggacccgag
ggccggccggtggcgggcaaggtgctggtggtgacgccggcgacgttggtggacaactgg
ggccgcgaggtcaagaagtggctgggctcggagcgcctgcaggcgctgtgcctacagcag
tccccgaccgccaagcagcaaatcctggagttccggcacggcgtgcaccagaagatgatg
atcactagctacgagacgctgcgcaagcacgccaaggacctggcgggcgtgttcgacctg
ctggtgtgtgacgaggggcacaggctcaagtccgtgggcggcaacaagaccatcgacgcg
ctgctgagcctgggctgccagcgccgggtgctgctgactggcacgcccgtgcagaacgac
ctgcaggagttctacgccctgctgtcgtttgtggcgcccgaggcgctgggcagcgcggcg
ttgttcaaccgggtgtacggcatccccatcacccgcagccaggagggcaccgccaccgcc
gaggacaaggagctgggcgcggcgaggtccagcgagctgaaggccaaggtgtcggccttc
atcctgcgccgcacgcaggcgctgctggccaagcacctgccgccgctggcctcgctcacg
ctgttctgcaggcccaccgagcagcaggtgtccctgtatacggcggtgctgcgctccaag
gcggtagcgtcgctgctgggcggcggcggcggtggcggtgaggacaacacgctggcggtc
atcaccgcactgcgcaaggcaagaactcagtgcaagatgcaggtgctgagcgagctgctg
cgcggcattggcgcggtgggcgagcgctgtgtggttgtgtccaccagcacggcggcgctg
gacctggtgggccggctgagcacggtgcgcatcgacggcgccaccagtgtggacggccgc
cagatcatcgtggacaacttcaacaagctcaacatgggccaggtgttcctgctgtccacg
cgcgcgggcggcgccgggctcaacctggtgggcgccaaccacctggtgctgtacgacagt
gattggaacccggcgatggaccagcaggccatggcgcgcatctggcgggacggccagacc
aagccgtgccacgtgtaccgcatgctcaccaccggcaccatcgaggagaaggtgtaccag
cgccagctcatgaaagccgatctggccagtgccaccatggtgggcggcggcgccggcggc
ggcggcaagagcggcggcggcaagttcacgcgcgaggagctgcgcgcgctgttctcgctc
aacaccgccaccgcctccgacacgcgcgacctcctgccgccgggccgcgtggcggggctg
cgctggctggagccggaggagtttgctgcgccggccgacagcccgctggccgtggcggtg
gccacaggtctggtcacctgcatcaaccagatggcggcgcacagcctggaaccggaggag
gctgtggcggcggcgccaggctgcgagggggccgccggcggcgccgctgccggctccggc
agtggcgcacagccgatgggggcggaagagtccctgcagcgggagggcgcaggcgtgggc
aagccggcgcgtgccgcgcggcgcgcgagagcgcaggcgcaggcggtcgtggagagcgag
gacagcatggacggcgatttcgaggatgggaagggcgcacaggagtctgaagaagaggtg
gacgtggaggaggaggcagtggaggaggcgccggcgccggcgccgccctcacagcggcgg
aggctgctgcagagccagggtgcgggacaggccgggcagcaggaggaggaggtggtggtg
gctgccgccgccggcgctgacagcgggctacccgccgcgcatgataacccggatgagctg
aacctggaggactggtag

DBGET integrated database retrieval system