KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_145462Help
Entry
CHLREDRAFT_145462 CDS       T01039                                 

Definition
CREB-binding protein
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
cre  Chlamydomonas reinhardtii
Brite
Enzymes [BR:cre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CHLREDRAFT_145462
Transcription factors [BR:cre03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    CHLREDRAFT_145462
Mitochondrial biogenesis [BR:cre03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    CHLREDRAFT_145462
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1156 aa AA seqDB search
MVPMGAPAMPMGNNGSPMLNGMGMFNAPQQTVPNGGPGGVNPMGQVPAMPAPIPNGGLPG
MNAAGGADDPAKQREQSIQKQQRWLLFLRHCAKCRAPGEDCQLKSQCKFGKQLWQHILSC
QNPACEYPRCTNSKDLLKHHQKCQEQTCPVCMPVKDYVKKTRQATQQQQQMQQQQQIQQQ
QQQQMQQQQMQQQQLQQQQMQQQQQMQQQQQPGVGANFMPTPPMMPNGMFPQQQPQQAMR
LNANGLGGQKRPHEMMGMSSGGMDGMNQMVPVGGGGMGMSMPMGMNNPMQGGMPLQPPPQ
VQAPGQGPMMSAPQQQQQQPAPKRAKTDDVLRQNTGTSLLETFDAKQIRVHVDLIRAAAV
TQKAQQPPPANPDDACKVCALTKLSFEPPVIYCSSCGLRIKRGQIFYSTPPDHGNDLKGY
FCHQCFTDQKGERILVEGVSIKKSDLVKRKNDEEIEEGWVQCDHCEGWVHQICGMFNKGR
NNTDVHYLCPDCLAVGYERGQRQKTEVRPQAMLEAKDLPTSRLSEFITERLNRELEKEHH
KRAEQQGKPLHEVAKPEPLTVRMINSVMKKCEVKPRFHETFGPTDGYPGEFGYRQKVLLL
FQSLDGVDVCLFCMYVQEYGKDCPAPNTNVVYLSYLDSVKYFRPEIPSALGPAVSLRTFV
YHQLLIAYVEFTRNMGFEQMYIWACPPMQGDDYILYCHPTKQKTPRSDRLRMWYIEMLKL
AKEEGIVKHLSTLWDTYFEGGRDHRMERCSVTYIPYMEGDYWPGEAENQLMAINDAAKGK
PGTKGAGSAPSRKAGAKGKRYGGGPATADEQLMARLGEILGGNMREDFIVVHMQVPCTFC
RAHIRGPNVVYRYRTPPGATPPKAAPERKFEGIKLEGGGPSVPVGTVSSLTICEACFRDE
ETRTLTGQQLRLPAGVSTAELAMEKLEEMIQWDRDPDGDMESEFFETRQTFLSLCQGNHY
QFDTLRRAKHSSMMVLYHLHNPHSPAFASSCNQCNAEIEPGSGFRCTVCPDFDMCASCKV
NPHKRALDETRQRLTEAERRERNEQLQKTLALLVHACGCHNSACGSNSCRKVKQLFQHAV
HCQSKVTGGCQLCKKMWCLLNLHAKSCTRADCPVPRCKELKELRRRQTNRQEEKRRAAYA
AMLRNQMAGSQAPRPM
NT seq 3471 nt NT seq  +upstreamnt  +downstreamnt
atggtgcctatgggcgcgccggcgatgccgatggggaacaatggctcgcccatgttgaac
gggatgggcatgttcaacgcgccgcaacagactgttcccaacggggggccaggcggcgtg
aacccgatgggccaggtgccagccatgcccgcgccgatacccaacggagggctgccaggc
atgaacgcggccggaggtgcggacgacccggctaagcagcgggagcaatccattcagaaa
cagcagcgctggctgctgttcttgcggcactgcgccaagtgccgggcgcccggggaggac
tgccagctgaagtcgcagtgcaagtttggcaagcagctgtggcagcacatcctttcgtgc
cagaaccccgcgtgcgagtacccgcggtgcacgaactccaaggacctactgaagcaccac
cagaagtgccaggagcagacgtgcccggtgtgcatgccggtgaaggactacgtgaagaag
acgcgccaggcgacgcagcagcaacagcaaatgcaacagcagcagcagatccagcagcag
cagcaacagcagatgcaacaacagcagatgcaacaacagcaactgcagcaacagcagatg
cagcagcagcagcaaatgcagcagcaacagcagccgggtgtgggcgccaacttcatgccg
acaccacccatgatgccgaacggcatgtttccgcagcagcagccgcaacaggcaatgagg
ctgaacgcaaacggcctcgggggccagaagcggccacacgagatgatgggcatgagcagc
ggcggcatggatggcatgaaccagatggtgccggtgggtggcggcggcatgggcatgtcc
atgcccatgggaatgaacaatcccatgcagggcggtatgccgctgcagccgccgccacag
gtgcaggcgccgggccagggccccatgatgtcggcgccgcagcagcagcaacagcagccg
gcacccaagcgtgcgaagacggacgacgtactgcggcagaacacgggaacgtcgctactg
gagaccttcgacgcgaagcaaattcgcgtacacgttgacctcattcgcgcggcggcggtg
acgcagaaggcacaacagccgccgccggcgaacccggacgatgcctgcaaggtgtgcgcg
ctgacgaagctgtcgttcgagccgcccgtgatctactgctcgtcatgcggcctgcgcatc
aagcgcggacagatcttctacagcacgccgccggaccacggcaacgacctgaagggctac
ttctgccaccagtgcttcacagaccaaaagggcgagcgcatcttggtggagggcgtgtcc
atcaagaaatccgacctggtgaaacggaaaaacgacgaggagatcgaggagggctgggtg
cagtgcgaccactgcgagggctgggtgcaccagatctgcggcatgttcaacaagggccgc
aacaacaccgacgtgcactacctgtgtccggactgcctggcggtgggctacgagcggggc
cagcggcaaaaaacggaggtgcggccgcaagccatgctcgaagccaaggacttgccgacc
agtcggctcagcgagttcatcacggagcggctcaaccgggagctggagaaggagcaccac
aagcgagccgagcagcagggcaagccgctgcacgaggtggccaagccggagccgctgacg
gtgcgcatgattaacagcgtgatgaagaagtgcgaggtgaagccgcgcttccacgagacg
ttcggccctaccgacggctaccccggcgagttcggctaccggcagaaggtgctgctgctg
ttccagagcctggacggcgtggacgtgtgcctgttctgcatgtacgtccaggagtacggc
aaggactgcccggcgcccaacaccaacgtggtgtacctgtcgtacctggactcggtcaag
tacttccggccggagatcccgtccgcgctggggcccgccgtgtcgctgcgcaccttcgtg
taccaccagctgctcattgcctacgtggagttcacgcgcaacatgggcttcgagcagatg
tacatttgggcgtgcccgcccatgcagggcgacgactacatcctgtactgccacccaacc
aagcagaagacgccgcgctcggaccggctgcgcatgtggtacatcgagatgctaaagctg
gccaaggaggagggcatcgtcaagcacctgtccacgctgtgggacacgtactttgagggc
gggcgggaccatcgcatggagcgctgcagcgtcacctacatcccctacatggagggcgac
tactggccgggcgaggcggagaaccagctgatggcgatcaacgacgcggcgaaggggaag
cccgggacgaagggcgcggggtcggcgccgagccggaaggcgggcgccaagggcaagcgc
tacggcggcggccccgcgacggcggacgagcagctcatggcgcggctgggcgagatcctg
ggcggcaacatgcgcgaggacttcatcgtggtgcacatgcaggtgccctgcaccttttgc
cgggcgcacatccgcggccccaacgtcgtgtaccgctaccgcacgccgcccggcgccacg
ccgcccaaggccgcgccggagcgcaagttcgagggcatcaagctggagggcggcgggccg
tcggtgccggtgggcaccgtgtcgtcgctcaccatctgcgaggcgtgcttccgtgacgag
gagacgcgcacgctgacgggccagcaactgcggctgccggcgggcgtgagcacggcggag
ctggcgatggagaagctggaggagatgatccagtgggaccgggacccggacggcgacatg
gagagcgagttcttcgagacgcgccagaccttcttgtcgctgtgccagggcaaccactac
cagttcgacacgctccggcgcgccaagcacagcagcatgatggtgctgtaccacctccac
aacccgcactcgccggcgttcgccagcagctgcaaccagtgtaatgcggagatcgagccc
ggcagcggcttccgctgcacggtgtgcccggacttcgacatgtgcgccagctgcaaggtc
aacccgcacaagcgcgctctggacgagacacggcaacggttgacggaggcggagcgccgg
gaacggaacgagcagctgcagaagacgctcgcacttctggtgcacgcgtgcggctgccac
aacagcgcctgcggcagcaacagctgccgcaaggtgaagcagctgttccagcacgccgtg
cactgccagtccaaggtgacgggcggctgccagctgtgcaagaagatgtggtgcctgctc
aacctgcacgccaagagctgcacgcgggcggactgcccggtgccgcgctgcaaggagctc
aaggagctgcggcggcgccaaacgaaccggcaggaggagaagcgccgcgcggcgtacgca
gctatgctgcgtaaccagatggctggctcgcaggcaccgcggcctatgtaa

DBGET integrated database retrieval system