KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_145963Help
Entry
CHLREDRAFT_145963 CDS       T01039                                 

Definition
hypothetical protein
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
cre  Chlamydomonas reinhardtii
Brite
Enzymes [BR:cre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     CHLREDRAFT_145963
Protein kinases [BR:cre01001]
 Serine/threonine protein kinases: Other group
  TTK family
   CHLREDRAFT_145963
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1256 aa AA seqDB search
MNEEAILASGPSGRSSKANPVLAQLYQRAIELVPRSRGHASEEYMYRSEDEGRDLLKALK
NQHLRDTCGLLYYEWALLEQQAGNTSKAVAILQKGIKEQAEPRSMLVGLLAQLQPSLSGA
DGAGAEAAAPVPERRVHFQDVDMASAENPAAGLARRAAPSTPGASLKLGEAGSCATSTSY
THLSGTSSTSKSSTTMLPGDLSLGISSHHHVHNLTGLVASKSQASCLSNSSEDDTINCRS
SAAEDNRTQGSLGAAGAGLGTLAGGGGNSTATVTMPAGIASSFNLAAGAAAVAALGSGVA
AGTTSGGGSGGGGGNNTANMSMGLRRFGLKSKAVRITSGDKPSGSANAADAGAVPASGAA
QPALDVPLAPSGGAFDDGDDAATRKRRAAAEAAQSPARMVASVVLQDEGMKRRHSPDLAA
AAAAGGISGLDRQAPRGAMEPAQQPTQLPARLATGDLGSLRPGSVAAPRQPLVPATPGGS
VTAAMPVAAGLSAVPAPVPVAVDRVLATPGPGPTPLGSRPATSRPQDVENMAPGPTPAPA
PGLGAMMPMDENCVPGGPGPLGTAAKPAKQPLVPAVSSTPLQPQQDGREPLRPMGYAAAR
PSPAPQPLAPVPAAGQLAPHPQPQIVPQPQQAPAPAARPQQQPGPLVAFNWQERLEQPQA
RPIESEMYVYVHGIRYQKLDLAGKGGSSKVYKVLGLNRAIYALKRVRFQNKDQEAVKGFI
DEIGLLRTLRGKPNIIQLIDAQVFREDGLVYMVLEYGDIDLARLLHSHEEARRRAAGGGE
AAEAAAAGSGNQCQEIDGNFIRLYWQQMLQAVKCIHDARIVHADLKPANFMLVQGQLKLI
DFGIAKAIQGDTTSINRESQVGTLNYMSPEAIQGGSQNPLGGPPLKVGRPSDVWSLGCIL
YQMIYGRTPFADLSFIPKMNAICNPAYQVPTPECGEPDAVDSIRRCLDRNPKTRISLPEL
LDHAFLHPNRRKPQPPPAAPAPAPPLPSGGGGMAGLTEEQIKAILQLGVAGGSSAADLDS
MARRVMQQLGGGGGLLMSTSASSTPAGAASASALRRGAAHGCTAATTACAAAAAAAAIWW
CAAPAAAAAPGLGDIAAMAAAAAAKRSAKPPLVDPLEARNAAAAAAAAAAAAGPTRAPAG
AAGGGGLPLMGAELHAAILQQRAQLRPVQEPQQQQEPVATTGQHAAAAQQVAGSAAAGPA
AARQGQAPAPSSEDNGLEAVLRRGLERFHFGDAGGDHTHGDTDFIEAAMTAARRDT
NT seq 3770 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaggaagccattctggcgtctggaccaagcggccgcagcagcaaggcaaacccc
gtgctcgcgcagctttaccagcgggccatcgagctggtcccccgcagccgcggccacgcc
tccgaggaatacatgtaccggagtgaggatgagggtcgtgacctgctgaaggcgctgaag
aaccagcacctgcgcgacacgtgcggtctgctgtactatgagtgggcgctactggagcag
caggcgggcaacacaagcaaagcagtggccatcctccaaaaggggataaaggagcaggcg
gaaccgcgcagcatgctggtggggctgctggctcagctccagcctagcctgagcggcgcg
gatggggcgggtgcggaggctgctgcgccggtgccggagcggcgggtgcacttccaggac
gtggacatggcgagcgcagagaaccctgctgccgggcttgctcgccgcgccgcgccgtcc
acgcccggcgccagcctcaagctcggggaggcgggcagctgcgccacctccacctcctac
acacacctctccggcaccagctccactagcaagagcagcaccacgatgctgcccggcgac
ctcagcctgggcatctccagccaccaccacgtgcacaacctcacgggcctggtcgctagc
aagagccaggcctcgtgcctcagcaacagctcggaggacgacaccatcaactgccgttcc
tccgccgcggaagataaccgcacccagggctcccttggcgcggcaggcgcggggctcggc
acgttggcgggtgggggtggcaacagcacagcgacggtgacgatgccagcgggcatcgca
agcagcttcaacctggccgctggtgctgctgccgtcgcggcgctgggcagcggcgtggcc
gccggcacgacgtctggtggcggctcgggtggcggcgggggcaacaacacagccaacatg
agcatgggcctgcgccggttcgggctgaagagtaaggccgtgcggatcaccagcggcgac
aaaccttcagggagcgccaacgctgcggacgcgggagcggtgcctgccagcggcgccgca
cagccggcgctggacgtgccgctggcgcctagcggtggcgcgttcgacgacggtgatgac
gcagccacgcgcaagcggcgcgcggcggcggaggcggcgcagtcgcctgctcgcatggtg
gcctcggtggtgctgcaggacgagggcatgaagcggcggcattcgccggatctggcggcg
gcggccgccgccgggggcatcagcggtctggaccggcaagcgccacggggcgcaatggaa
cccgcacagcagccaacgcagctgccagcacgccttgcgaccggagacctgggtagcctc
cggccgggcagcgtggcggcgccgcggcagccgctggtaccggccacaccgggaggctct
gtcactgcggccatgcccgtcgctgccgggctctcagcagtgccggcgccggtacctgtg
gccgttgaccgggtgctggccacccctgggccgggacctacgccgctgggctcgcgacct
gccacgtcgcggccgcaggatgtggagaacatggctcctgggccgacgcccgcgccggcg
cctgggcttggcgcgatgatgcccatggatgagaactgtgtgcccggcggcccggggccg
ctgggaacggctgcaaagccggcaaagcagcccctggtgccggcggtctccagcacgccg
ctgcagccgcagcaggacggtcgcgagccgctccggcctatgggctacgcggcggcacgg
ccatcacctgcgccgcagccattggcgcccgtgccagctgcgggtcagcttgcgccgcat
ccacagccgcagattgtgccccagccgcagcaggcgcctgcgccggcggcccggccgcag
cagcagccggggccgctggtggcgttcaactggcaggagcggctggagcagccgcaggcg
cggcccattgagagcgagatgtatgtgtacgtgcacggcatccgctaccagaagctggac
ctggcgggcaagggcggtagcagcaaggtgtacaaggtgctgggcctcaaccgcgccatc
tatgcgctcaagcgcgtgcgcttccagaataaggaccaggaggcggtcaagggcttcatc
gatgagattgggctgctgcggacactgcgcggcaagcccaacatcatccagctcatcgac
gcgcaggtgttccgcgaggacggtctggtgtacatggtgctggagtacggcgacattgac
ctggcgcggctgctgcacagccacgaggaggcgcggcggagggcggccgggggcggcgag
gccgcggaggcggcggcagccggcagcggaaaccagtgccaggagattgacggcaacttc
atccggctgtactggcagcagatgcttcaggccgtcaagtgcatccacgacgcacgcatc
gtgcacgccgacctcaagcccgccaacttcatgctggtgcaggggcagctcaagctgatc
gactttggcatcgccaaggccatccagggcgacaccacctccatcaaccgggagtcgcag
gtgggcactctcaactacatgtcgcccgaggccatccagggcggcagccagaaccccctg
ggcggcccgccgctcaaggtgggccggccctcggacgtgtggagcctgggctgcatcctg
taccagatgatctatggccgcacgccattcgcggacctgtccttcatccccaaaatgaac
gcaatctgcaaccccgcataccaggtgcccacgcccgagtgcggcgagccggatgccgtg
gacagcatccgcaggtgcctggaccgcaaccccaagacgcgcatctcgcttccggagcta
ctggaccacgccttcctacaccccaaccgccgcaagccgcagccaccgccggcggcgcct
gcgcccgcgccgccgctgcccagtggcggcggcggcatggcaggtctgacggaggagcag
atcaaagccattctgcagttgggtgtggcgggagggagcagcgcagcggacctggactcc
atggctcgccgcgtcatgcagcagctcggcggaggcggcgggctgctgatgtcaacgtcc
gcctcctccacccccgccggcgccgcctccgcctccgctcttcggcgcggcgccgcgcac
gggtgcaccgccgccaccaccgcctgcgccgccgccgccgccgccgccgctatttggtgg
tgcgctgcacctgcagccgcggcagcgccgggcctcggagacattgctgctatggcggca
gctgccgccgcgaagcggtctgccaagccgcccctggtggacccgctagaagctcgcaac
gcagccgccgccgcagcggccgcggcggcagcagcgggtccaacacgcgcgccggctggt
gccgccggcggtggcggcctgccgctgatgggcgcagaactgcacgccgccatcctgcag
cagcgggcgcagctgcggccagtgcaggagccgcagcagcagcaggagccggttgcgacc
acaggacagcacgcggcggcggcacagcaggtggcagggtcagcggcagcggggcccgcc
gccgccaggcaggggcaagcgccagcacccagtagcgaagacaacgggcttgaggcggtg
ttgcggcgcggtctggagcgcttccactttggcgacgccggcggcgaccacacacacggg
gacaccgactttattgaggccgccatgacagctgcccggcgggacacatg

DBGET integrated database retrieval system