KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_145987Help
Entry
CHLREDRAFT_145987 CDS       T01039                                 

Gene name
OGD2
Definition
(RefSeq) dihydrolipoamide succinyltransferase, oxoglutarate dehydrogenase E2 component
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cre  Chlamydomonas reinhardtii
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cre00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CHLREDRAFT_145987 (OGD2)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CHLREDRAFT_145987 (OGD2)
  Amino acid metabolism
   00310 Lysine degradation
    CHLREDRAFT_145987 (OGD2)
Enzymes [BR:cre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CHLREDRAFT_145987 (OGD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 450 aa AA seqDB search
MALRLFGRRAGQLGSSLAQATRAAAVATGELSASCSELFSRQSSVASSSHVREELAAFGV
ADARFRGLLHMRGLQTSALAMDAFEVQVPSMGESITEGTIANVLKKQGDAVKEDDIIAQI
ETDKVTIDVKYTGKAPGVISKVLINAADLVKVGQQVAIVETGGAAAAAAPAAAAPAAAAP
PPPPPKPVAAEPAKPAAPKAPAPAPAAPTGPSSPTPGPRPERRVKMTRLRMRVAERLKGA
QNTYAMLSTFNEVDMSAAIELRSTYKETFLEKHNVKLGFMSVFVKAAAHALQEVPSVNAV
IEGDEIIFRDFYDISIAVATPKGLVVPVLRRADELSFADVEKNINALGKKARDGTIGIDD
MAGGTFTISNGGVYGSLLSTPIINPPQSAILGMHAIVDRPVVVKGKIEIRPMMNIALTYD
HRLIDGREAVTFLRRIKDVVEDPRRLLLDI
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atggcgctccggctcttcgggcgccgcgcggggcaactaggtagctccttggcacaagct
acaagggccgccgctgtcgctaccggggagctgagcgcaagctgtagcgaactcttctcg
cgtcaatcaagcgtggccagctccagtcatgtgagggaggagctggccgcgttcggtgtt
gcggacgcccggttccgtgggcttctgcacatgcggggcctgcagacgtcggcactcgct
atggacgcgttcgaggtgcaggtgccctccatgggggaatccattacagagggcactatc
gcaaacgtgctgaagaagcagggtgacgctgtgaaggaggatgacatcattgcgcagatt
gagacggacaaggtgaccattgacgtcaagtacacgggcaaggcgcccggcgtgatcagc
aaggtgctgatcaacgccgcggacctggtcaaggtcgggcagcaggtggcgattgttgag
acgggcggtgccgctgccgctgcggcgccggctgctgcggcgccggctgccgccgcgccg
ccgccgccgccgcccaagcccgtggctgcggagcccgccaagccggcggcccccaaggcc
cctgcgccggctccggccgcgcccaccgggccgtcttcgcccacgcccggacctcgcccc
gagcggcgcgtgaagatgacccggctgcgcatgcgtgtggcggagcggctcaagggcgcg
cagaacacgtatgccatgctgtccaccttcaacgaggtggacatgagcgcggccatcgag
ttgcgctccacctacaaggagacgttcctggagaagcacaacgtcaagttgggtttcatg
agcgtgttcgtcaaggcggcggcacacgcgctgcaggaggtgccgtcggtcaacgccgtg
attgagggcgatgagatcatcttccgcgacttttacgacatctccatcgccgtggccacg
cccaagggcctggtggtgccggtgctacgccgcgcggacgagctcagcttcgccgacgtt
gagaagaacatcaacgcgctgggcaagaaggcgcgcgacggcaccatcggcatcgacgac
atggccggcggcaccttcaccatctccaacggcggcgtgtacggcagcctgctgtccacg
cccatcatcaacccgccgcagtcggccatcctgggcatgcacgccatcgtggaccggcca
gtggtggtcaagggcaagattgagatccggcccatgatgaacatcgcgctcacgtacgac
catcgcctgatcgacggccgcgaggcggtcaccttcctgcgccgcatcaaggacgtggtg
gaggacccgcgccgcctgctgctggacatctaa

DBGET integrated database retrieval system