KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_145987Help
Entry
CHLREDRAFT_145987 CDS       T01039                                 

Gene name
OGD2
Definition
dihydrolipoamide succinyltransferase, oxoglutarate dehydrogenase E2 component (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cre  Chlamydomonas reinhardtii
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:cre01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:cre00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:cre00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 450 aa AA seqDB search
MALRLFGRRAGQLGSSLAQATRAAAVATGELSASCSELFSRQSSVASSSHVREELAAFGV
ADARFRGLLHMRGLQTSALAMDAFEVQVPSMGESITEGTIANVLKKQGDAVKEDDIIAQI
ETDKVTIDVKYTGKAPGVISKVLINAADLVKVGQQVAIVETGGAAAAAAPAAAAPAAAAP
PPPPPKPVAAEPAKPAAPKAPAPAPAAPTGPSSPTPGPRPERRVKMTRLRMRVAERLKGA
QNTYAMLSTFNEVDMSAAIELRSTYKETFLEKHNVKLGFMSVFVKAAAHALQEVPSVNAV
IEGDEIIFRDFYDISIAVATPKGLVVPVLRRADELSFADVEKNINALGKKARDGTIGIDD
MAGGTFTISNGGVYGSLLSTPIINPPQSAILGMHAIVDRPVVVKGKIEIRPMMNIALTYD
HRLIDGREAVTFLRRIKDVVEDPRRLLLDI
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atggcgctccggctcttcgggcgccgcgcggggcaactaggtagctccttggcacaagct
acaagggccgccgctgtcgctaccggggagctgagcgcaagctgtagcgaactcttctcg
cgtcaatcaagcgtggccagctccagtcatgtgagggaggagctggccgcgttcggtgtt
gcggacgcccggttccgtgggcttctgcacatgcggggcctgcagacgtcggcactcgct
atggacgcgttcgaggtgcaggtgccctccatgggggaatccattacagagggcactatc
gcaaacgtgctgaagaagcagggtgacgctgtgaaggaggatgacatcattgcgcagatt
gagacggacaaggtgaccattgacgtcaagtacacgggcaaggcgcccggcgtgatcagc
aaggtgctgatcaacgccgcggacctggtcaaggtcgggcagcaggtggcgattgttgag
acgggcggtgccgctgccgctgcggcgccggctgctgcggcgccggctgccgccgcgccg
ccgccgccgccgcccaagcccgtggctgcggagcccgccaagccggcggcccccaaggcc
cctgcgccggctccggccgcgcccaccgggccgtcttcgcccacgcccggacctcgcccc
gagcggcgcgtgaagatgacccggctgcgcatgcgtgtggcggagcggctcaagggcgcg
cagaacacgtatgccatgctgtccaccttcaacgaggtggacatgagcgcggccatcgag
ttgcgctccacctacaaggagacgttcctggagaagcacaacgtcaagttgggtttcatg
agcgtgttcgtcaaggcggcggcacacgcgctgcaggaggtgccgtcggtcaacgccgtg
attgagggcgatgagatcatcttccgcgacttttacgacatctccatcgccgtggccacg
cccaagggcctggtggtgccggtgctacgccgcgcggacgagctcagcttcgccgacgtt
gagaagaacatcaacgcgctgggcaagaaggcgcgcgacggcaccatcggcatcgacgac
atggccggcggcaccttcaccatctccaacggcggcgtgtacggcagcctgctgtccacg
cccatcatcaacccgccgcagtcggccatcctgggcatgcacgccatcgtggaccggcca
gtggtggtcaagggcaagattgagatccggcccatgatgaacatcgcgctcacgtacgac
catcgcctgatcgacggccgcgaggcggtcaccttcctgcgccgcatcaaggacgtggtg
gaggacccgcgccgcctgctgctggacatctaa

DBGET integrated database retrieval system