KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_147241Help
Entry
CHLREDRAFT_147241 CDS       T01039                                 

Gene name
KDG2
Definition
diacylglycerol kinase (EC:2.7.1.-)
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
cre  Chlamydomonas reinhardtii
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:cre00600]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 542 aa AA seqDB search
MLDPQPAQLIPGAHLIGAKLETPCRFTVWWAQPYTSRTGCVTKHRFKACHSTRFETPDTV
AAQALVEYLRRRASWWGRASPPHVAAIVNPVSGKGSAQRLMEAQVLPLLRDVAGLRVTVH
VTQARMHAAELVRGLNLSCGSSAAEGAAGAAAASGSGAAPPVDLIMFVGGDGTLYEGLQG
LFQRPDWEAAVQCPMAAVPCGSGNGLAASAGLWDPVTAVVSVCRGRTEAVDVASVLQPPG
NRFYCLLSVVYGSMANLDIGTQHLRWMGELRFHLGGLWEIIRGRLYNCRIFVLPPAGEGA
EPLARDGNGTAGTGAASPQAVVITLPQGATEDTAAGGAGGASGAAAASSGKAGGGMHERL
LPARQSAGNAGGGAGGHVSDYPAGPPLPLLASLPGLPHPLPDSLDSLPAGWQQLPDSFAI
LGAYNTQYLALGARANPGGRMGDGAWDVWHMAADGGAHRGKRASGGVRARALKVLLGIED
GGFAKSPGVMRTTKARALMFEQRDSATWTVLDGEEVPNLPLYLEVHQGICRLLVAPLFEE
LD
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgcttgacccgcaacccgcgcagctgattcctggggcgcacctgattggcgccaagctc
gagacgccatgccggttcacggtgtggtgggcacagccctacaccagccgcaccggctgc
gtcaccaagcaccggttcaaggcttgccactccacacggtttgagacgccggacaccgtg
gctgcacaggcgctggtggagtacctgcggcgccgcgccagctggtggggccgggcctcg
ccgccgcacgtggccgccatcgtcaacccggtcagcggcaagggctcggcgcagcggctg
atggaggcgcaggtgctgccgctactgcgggacgtggcggggctgagggtcaccgtgcac
gtgacacaggctcgcatgcacgcggcggagctggttcgaggcctgaacctcagctgcggt
agcagtgcggcggagggagccgccggtgccgccgcggcctcggggtcgggtgctgcaccc
cctgtggacctgatcatgttcgtgggcggggacggcaccttgtacgagggcctgcagggc
ctgttccagcgccccgactgggaggcggcggtgcagtgccccatggcggcggtgccgtgc
ggcagcggcaacggactggcggccagcgcggggctgtgggacccggtcacggcggtggtg
tccgtgtgccgcggccgcacggaggcggtggacgtggccagtgtgctgcagccgccgggc
aaccgcttctactgcctgctgtcggttgtgtacggctccatggccaacctcgacatcggc
acacaacatctgcggtggatgggcgagctgcgcttccacctgggtgggctgtgggaaatc
atccgcggccgcctctacaactgccgcatctttgtgctgccgccagccggcgagggggcc
gagccgctggcacgcgacggcaacggtaccgccggcaccggcgccgcctcgccccaagca
gtggtcatcaccttgcctcaaggggcgactgaggacacggcggctggcggcgccggcggt
gcaagcggggctgctgctgccagcagcggcaaagccggtggcggcatgcacgagcggctg
ctgccggcgcgccagtcagcggggaatgcgggtggcggtgcgggtggacatgtatccgac
taccctgcagggccgccgttgccgctgctggcctcgctgcccggcctgccgcatccgctg
cccgacagcctggatagcctgccggcgggctggcagcagctgccggactcgttcgccatc
ctgggcgcctacaacacgcagtacctggcgctgggggcgcgggcaaaccccggcggccga
atgggcgacggcgcctgggacgtgtggcacatggcggcagacggcggggctcacaggggc
aagcgggcgagcggcggcgtgcgtgcgcgcgcactcaaggtgctactggggattgaggac
ggcggctttgcaaagtcgccgggcgtgatgcggacaaccaaggctcgcgcgctgatgttt
gagcaacgcgactctgcgacgtggacggtgctggatggcgaggaggtgcccaacctgccc
ctgtaccttgaggtgcaccagggcatttgccgcctgctggtggcgccgctgtttgaggag
ctggattga

DBGET integrated database retrieval system