KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_147241Help
Entry
CHLREDRAFT_147241 CDS       T01039                                 

Gene name
KDG2
Definition
diacylglycerol kinase (EC:2.7.1.-)
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
cre  Chlamydomonas reinhardtii
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:cre00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    CHLREDRAFT_147241 (KDG2)
Enzymes [BR:cre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     CHLREDRAFT_147241 (KDG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 542 aa AA seqDB search
MLDPQPAQLIPGAHLIGAKLETPCRFTVWWAQPYTSRTGCVTKHRFKACHSTRFETPDTV
AAQALVEYLRRRASWWGRASPPHVAAIVNPVSGKGSAQRLMEAQVLPLLRDVAGLRVTVH
VTQARMHAAELVRGLNLSCGSSAAEGAAGAAAASGSGAAPPVDLIMFVGGDGTLYEGLQG
LFQRPDWEAAVQCPMAAVPCGSGNGLAASAGLWDPVTAVVSVCRGRTEAVDVASVLQPPG
NRFYCLLSVVYGSMANLDIGTQHLRWMGELRFHLGGLWEIIRGRLYNCRIFVLPPAGEGA
EPLARDGNGTAGTGAASPQAVVITLPQGATEDTAAGGAGGASGAAAASSGKAGGGMHERL
LPARQSAGNAGGGAGGHVSDYPAGPPLPLLASLPGLPHPLPDSLDSLPAGWQQLPDSFAI
LGAYNTQYLALGARANPGGRMGDGAWDVWHMAADGGAHRGKRASGGVRARALKVLLGIED
GGFAKSPGVMRTTKARALMFEQRDSATWTVLDGEEVPNLPLYLEVHQGICRLLVAPLFEE
LD
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgcttgacccgcaacccgcgcagctgattcctggggcgcacctgattggcgccaagctc
gagacgccatgccggttcacggtgtggtgggcacagccctacaccagccgcaccggctgc
gtcaccaagcaccggttcaaggcttgccactccacacggtttgagacgccggacaccgtg
gctgcacaggcgctggtggagtacctgcggcgccgcgccagctggtggggccgggcctcg
ccgccgcacgtggccgccatcgtcaacccggtcagcggcaagggctcggcgcagcggctg
atggaggcgcaggtgctgccgctactgcgggacgtggcggggctgagggtcaccgtgcac
gtgacacaggctcgcatgcacgcggcggagctggttcgaggcctgaacctcagctgcggt
agcagtgcggcggagggagccgccggtgccgccgcggcctcggggtcgggtgctgcaccc
cctgtggacctgatcatgttcgtgggcggggacggcaccttgtacgagggcctgcagggc
ctgttccagcgccccgactgggaggcggcggtgcagtgccccatggcggcggtgccgtgc
ggcagcggcaacggactggcggccagcgcggggctgtgggacccggtcacggcggtggtg
tccgtgtgccgcggccgcacggaggcggtggacgtggccagtgtgctgcagccgccgggc
aaccgcttctactgcctgctgtcggttgtgtacggctccatggccaacctcgacatcggc
acacaacatctgcggtggatgggcgagctgcgcttccacctgggtgggctgtgggaaatc
atccgcggccgcctctacaactgccgcatctttgtgctgccgccagccggcgagggggcc
gagccgctggcacgcgacggcaacggtaccgccggcaccggcgccgcctcgccccaagca
gtggtcatcaccttgcctcaaggggcgactgaggacacggcggctggcggcgccggcggt
gcaagcggggctgctgctgccagcagcggcaaagccggtggcggcatgcacgagcggctg
ctgccggcgcgccagtcagcggggaatgcgggtggcggtgcgggtggacatgtatccgac
taccctgcagggccgccgttgccgctgctggcctcgctgcccggcctgccgcatccgctg
cccgacagcctggatagcctgccggcgggctggcagcagctgccggactcgttcgccatc
ctgggcgcctacaacacgcagtacctggcgctgggggcgcgggcaaaccccggcggccga
atgggcgacggcgcctgggacgtgtggcacatggcggcagacggcggggctcacaggggc
aagcgggcgagcggcggcgtgcgtgcgcgcgcactcaaggtgctactggggattgaggac
ggcggctttgcaaagtcgccgggcgtgatgcggacaaccaaggctcgcgcgctgatgttt
gagcaacgcgactctgcgacgtggacggtgctggatggcgaggaggtgcccaacctgccc
ctgtaccttgaggtgcaccagggcatttgccgcctgctggtggcgccgctgtttgaggag
ctggattga

DBGET integrated database retrieval system