KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_153242Help
Entry
CHLREDRAFT_153242 CDS       T01039                                 

Definition
(RefSeq) predicted protein
  KO
K19477  cGMP-dependent protein kinase 2 [EC:2.7.11.12]
Organism
cre  Chlamydomonas reinhardtii
Brite
Enzymes [BR:cre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     CHLREDRAFT_153242
Protein kinases [BR:cre01001]
 Serine/threonine kinases: AGC group
  PKG family
   CHLREDRAFT_153242
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase cNMP_binding Pkinase_Tyr Kinase-like
Motif
Other DBs
NCBI-GeneID: 5726122
NCBI-ProteinID: XP_001700571
JGI: 153242
UniProt: A8JDQ7
Position
Unknown
AA seq 720 aa AA seqDB search
MGADNSKYADGEGGQVAYIAQRTQVGRAKAITANKVLGGATKLDIKLPPKASRADATDYE
FIKSSLVNLLLFSRLDRITANRIVAEMYALPVQAGEILIQQGDSGDAATKLFVVRSGKFE
VLERRKDVMFKVNTKERGDVFGEISLMYDCPRSATVAATTDASVWVLERDVFRHFVQASV
EDEKGQIQLFLNSVPLLSSLRPDEKMLLVDAFQEEAFVAGARVIMEGDVGDKFYIIKEGE
AQVIQGDREVNRLFRSDFFGEQALLQDEPRKATVRALTPLVCLTLDRRTFVAVLGPLQDI
MAKEKSPEVVNQRMAKLKPQGSAAHRRPVAEVIIKYDAARRSIVCDGHLDEVVELRRGGQ
KMAAELRDAERKLVLVEGELLGEGAFSRVCKVTEETTGRVFALKRMAKSAALQCPEHVFC
EQHITRNIAHPFCLRQYASFQDKANLYMLFDLMPGGDLMDVLVAEAKVIKYPVADKNSLR
KGCLAPKMKMWQGMEEPMSKFYIASIVLALEYLHDNSIAFRDLKPENVLIDGQGYVKLGD
FGFAKQVDLGGRTYTFCGTPGYVAPENVMGRGYNHSVDWWTLGVLMYVLLTARQPFTSPK
TQDPMEVMRRIVDDRWPIKYPPYMSDEARDLISHLLERKPVKRIGMLQGKARDIKMHPWF
AGFDWDALAARRMDPPRKPKEADSAKRKTELAEAHRAEPRELQTISPQEAAEWDRVFKDF
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgggagccgataactcgaaatacgccgatggcgagggcggacaggtggcttatatcgcc
cagcggacccaggttgggcgtgcaaaggccattacagccaataaggtgctgggcggtgcc
accaagctcgatatcaagttgccaccgaaagcttcccgcgctgacgccacggactatgag
ttcatcaagagctcgctggtgaacctgctgctgttcagccggctggaccgtatcaccgcg
aaccgcattgtggcggaaatgtatgccctgccggtgcaagcgggcgaaatcctcattcag
cagggtgactcgggcgatgcagcaaccaagctttttgttgtgcggagtggcaagttcgag
gtgctggagcgccggaaggatgtgatgtttaaggtcaacaccaaggagcgcggtgacgtg
ttcggcgagatcagtctgatgtacgactgcccacgctccgccaccgtggcggccacaacg
gacgccagcgtctgggtgctggagcgcgacgtcttccggcattttgtgcaggcgtccgtg
gaagacgagaagggtcaaatccagctcttcctgaacagcgtgccgctgctgtcctcgctg
cggccagatgagaagatgctgctggtggatgcgtttcaagaggaggcgtttgtggcgggc
gcgcgtgtgatcatggagggcgacgtgggcgacaagttctacatcatcaaagagggcgag
gcgcaggtgatccagggcgacagagaggtgaaccgactattccgctcggactttttcggc
gagcaggcgctgctgcaggatgagccccggaaagccaccgtacgcgcgctgacgccgctg
gtgtgcttgacgctagaccgccgcaccttcgtggcggtgttggggccgctgcaggacatc
atggcgaaggagaagagccccgaggtggtgaaccagcgtatggccaagttgaaaccccag
ggcagcgccgcgcaccggcggccggttgcggaggtgatcatcaagtatgatgccgcgcga
cggtccattgtgtgcgatggccacttggacgaggtggtggagctgcgccgtggcggccag
aagatggcggccgagctgcgtgacgcggaaaggaagctggtgcttgtggagggcgagctg
ctgggcgagggtgcgttcagccgcgtctgcaaggtgacagaggagaccaccggccgcgtg
ttcgcgctgaagcgcatggccaagtctgcggcgctgcagtgcccggagcacgtgttctgc
gagcagcacatcacgcgcaacattgcgcacccgttctgtctgcgccagtacgcctcgttc
caggataaggccaacctgtacatgctgttcgacctgatgcccggcggcgatctcatggat
gtgctggtggcggaggccaaggtgatcaagtacccagtggcagacaagaactcgctgcgc
aagggctgcctggcgcccaagatgaagatgtggcagggcatggaggagcccatgtccaag
ttctacatcgcctccatcgtgctggcgctcgagtacctgcacgacaactccattgccttc
cgtgacctcaagcccgagaacgtgctcatcgacggccagggctacgtcaagctgggcgac
ttcggcttcgccaagcaggtcgacctgggtggccgcacctacaccttctgtggcacgccc
ggctacgttgcccccgagaacgttatggggagaggctacaaccactccgtggactggtgg
acgctgggtgtgctcatgtacgtgctgctcacggcgcggcagccgttcacgtcgcccaag
acgcaggaccccatggaggtcatgcgccgcatcgtggacgaccgctggcccatcaagtac
ccgccctacatgtccgacgaggcgcgcgacctcatctcgcacctgctggagcgcaagccc
gtgaagcgcatcggcatgctgcagggcaaggcccgcgacatcaagatgcacccctggttc
gcgggctttgactgggacgcgctggcagcgcgccgcatggacccgccgcgcaagcccaag
gaggcggacagcgccaagcgcaagacggagctggcggaggcgcaccgcgccgagccgcgc
gagctgcaaaccatctcgccgcaggaggcggccgagtgggaccgcgtgttcaaggacttt
taa

DBGET integrated database retrieval system