KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_153242Help
Entry
CHLREDRAFT_153242 CDS       T01039                                 

Definition
(RefSeq) hypothetical protein
Organism
cre  Chlamydomonas reinhardtii
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 720 aa AA seqDB search
MGADNSKYADGEGGQVAYIAQRTQVGRAKAITANKVLGGATKLDIKLPPKASRADATDYE
FIKSSLVNLLLFSRLDRITANRIVAEMYALPVQAGEILIQQGDSGDAATKLFVVRSGKFE
VLERRKDVMFKVNTKERGDVFGEISLMYDCPRSATVAATTDASVWVLERDVFRHFVQASV
EDEKGQIQLFLNSVPLLSSLRPDEKMLLVDAFQEEAFVAGARVIMEGDVGDKFYIIKEGE
AQVIQGDREVNRLFRSDFFGEQALLQDEPRKATVRALTPLVCLTLDRRTFVAVLGPLQDI
MAKEKSPEVVNQRMAKLKPQGSAAHRRPVAEVIIKYDAARRSIVCDGHLDEVVELRRGGQ
KMAAELRDAERKLVLVEGELLGEGAFSRVCKVTEETTGRVFALKRMAKSAALQCPEHVFC
EQHITRNIAHPFCLRQYASFQDKANLYMLFDLMPGGDLMDVLVAEAKVIKYPVADKNSLR
KGCLAPKMKMWQGMEEPMSKFYIASIVLALEYLHDNSIAFRDLKPENVLIDGQGYVKLGD
FGFAKQVDLGGRTYTFCGTPGYVAPENVMGRGYNHSVDWWTLGVLMYVLLTARQPFTSPK
TQDPMEVMRRIVDDRWPIKYPPYMSDEARDLISHLLERKPVKRIGMLQGKARDIKMHPWF
AGFDWDALAARRMDPPRKPKEADSAKRKTELAEAHRAEPRELQTISPQEAAEWDRVFKDF
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgggagccgataactcgaaatacgccgatggcgagggcggacaggtggcttatatcgcc
cagcggacccaggttgggcgtgcaaaggccattacagccaataaggtgctgggcggtgcc
accaagctcgatatcaagttgccaccgaaagcttcccgcgctgacgccacggactatgag
ttcatcaagagctcgctggtgaacctgctgctgttcagccggctggaccgtatcaccgcg
aaccgcattgtggcggaaatgtatgccctgccggtgcaagcgggcgaaatcctcattcag
cagggtgactcgggcgatgcagcaaccaagctttttgttgtgcggagtggcaagttcgag
gtgctggagcgccggaaggatgtgatgtttaaggtcaacaccaaggagcgcggtgacgtg
ttcggcgagatcagtctgatgtacgactgcccacgctccgccaccgtggcggccacaacg
gacgccagcgtctgggtgctggagcgcgacgtcttccggcattttgtgcaggcgtccgtg
gaagacgagaagggtcaaatccagctcttcctgaacagcgtgccgctgctgtcctcgctg
cggccagatgagaagatgctgctggtggatgcgtttcaagaggaggcgtttgtggcgggc
gcgcgtgtgatcatggagggcgacgtgggcgacaagttctacatcatcaaagagggcgag
gcgcaggtgatccagggcgacagagaggtgaaccgactattccgctcggactttttcggc
gagcaggcgctgctgcaggatgagccccggaaagccaccgtacgcgcgctgacgccgctg
gtgtgcttgacgctagaccgccgcaccttcgtggcggtgttggggccgctgcaggacatc
atggcgaaggagaagagccccgaggtggtgaaccagcgtatggccaagttgaaaccccag
ggcagcgccgcgcaccggcggccggttgcggaggtgatcatcaagtatgatgccgcgcga
cggtccattgtgtgcgatggccacttggacgaggtggtggagctgcgccgtggcggccag
aagatggcggccgagctgcgtgacgcggaaaggaagctggtgcttgtggagggcgagctg
ctgggcgagggtgcgttcagccgcgtctgcaaggtgacagaggagaccaccggccgcgtg
ttcgcgctgaagcgcatggccaagtctgcggcgctgcagtgcccggagcacgtgttctgc
gagcagcacatcacgcgcaacattgcgcacccgttctgtctgcgccagtacgcctcgttc
caggataaggccaacctgtacatgctgttcgacctgatgcccggcggcgatctcatggat
gtgctggtggcggaggccaaggtgatcaagtacccagtggcagacaagaactcgctgcgc
aagggctgcctggcgcccaagatgaagatgtggcagggcatggaggagcccatgtccaag
ttctacatcgcctccatcgtgctggcgctcgagtacctgcacgacaactccattgccttc
cgtgacctcaagcccgagaacgtgctcatcgacggccagggctacgtcaagctgggcgac
ttcggcttcgccaagcaggtcgacctgggtggccgcacctacaccttctgtggcacgccc
ggctacgttgcccccgagaacgttatggggagaggctacaaccactccgtggactggtgg
acgctgggtgtgctcatgtacgtgctgctcacggcgcggcagccgttcacgtcgcccaag
acgcaggaccccatggaggtcatgcgccgcatcgtggacgaccgctggcccatcaagtac
ccgccctacatgtccgacgaggcgcgcgacctcatctcgcacctgctggagcgcaagccc
gtgaagcgcatcggcatgctgcagggcaaggcccgcgacatcaagatgcacccctggttc
gcgggctttgactgggacgcgctggcagcgcgccgcatggacccgccgcgcaagcccaag
gaggcggacagcgccaagcgcaagacggagctggcggaggcgcaccgcgccgagccgcgc
gagctgcaaaccatctcgccgcaggaggcggccgagtgggaccgcgtgttcaaggacttt
taa

DBGET integrated database retrieval system