KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_157049Help
Entry
CHLREDRAFT_157049 CDS       T01039                                 

Gene name
UGP1
Definition
UDP-glucose pyrophosphorylase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cre  Chlamydomonas reinhardtii
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cre00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CHLREDRAFT_157049 (UGP1)
   00052 Galactose metabolism
    CHLREDRAFT_157049 (UGP1)
   00500 Starch and sucrose metabolism
    CHLREDRAFT_157049 (UGP1)
   00520 Amino sugar and nucleotide sugar metabolism
    CHLREDRAFT_157049 (UGP1)
Enzymes [BR:cre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CHLREDRAFT_157049 (UGP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 474 aa AA seqDB search
MAGDFAAFEAKMKAANLSQAAIAAFKKNYDQLVAGVTGMVAEADISSADGLPYLTSLPHV
SPADAKSLLSATAVLKLNGGLGTSMGLEKAKSLLVVKDGKTFLDLICEQVKHMRATYGSQ
VVFTLMNSFSTSDDTRAFLAAAHPDLLQEPLIELLQNKSPKVDAASLSPASYPAQPDMEW
CPPGHGDIYPSLLGSGMLDALAGQGIKYLFVSNSDNLGATLDLDLLHYFATSNKAFLMEV
CERTAADKKGGHLCVRKADGRLMLRESAMCPDADKKAFEDIAKHKYFNTNNLWVSLEALA
ATLKSSGGALDLPLIKNKKTVNPRDAASPPVFQLETAMGSAIECFDSAGAIVVPRSRFAP
VKTCSDLFVLRSDAYVIAEDSTVAVAPALKGAIPLVKLDDGHYKLVDQMEALAPAVPSLL
HASSLTVKGAVKFSPGVVLKGEVTLEAEGSGPAVLTAGEYSGAVKLGEPAKVAA
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcgactttgctgctttcgaggcgaagatgaaggccgcgaacctttcgcaagcc
gcgatagcggccttcaagaagaactacgaccagctggtggctggtgtgaccggcatggtg
gcggaggccgacatctccagcgccgacgggctgccgtacctcacctccctgccgcacgtg
tctcccgcggatgccaagtcgctgctgtccgccacggctgtgctcaagctgaacggcggg
ctgggcaccagtatgggtctggagaaggccaagagcctgctggtggtcaaggacggcaag
accttcctggacctcatctgcgagcaggtgaagcacatgcgcgccacgtacggcagccag
gtggtgttcacgctcatgaacagcttcagcaccagcgacgacactcgcgccttcctggcg
gcggcacacccagacctgctgcaggagcccctgattgagctgcttcagaacaagagcccc
aaggtggacgccgccagcctcagccccgccagctaccccgcgcagcccgacatggagtgg
tgcccccccggccacggcgacatctacccctcattgctgggcagtggcatgctggacgcg
ctggccgggcagggcatcaagtacctgtttgtgtccaactcggacaacctgggcgccacg
ctggatctggacctgttgcactacttcgccaccagcaacaaggccttcctcatggaggtt
tgcgagcgcaccgctgcggacaagaagggcggccacctgtgtgtgcgcaaggccgacggg
cggctgatgctgcgtgagagcgccatgtgccccgacgccgacaaaaaggcgttcgaggac
atcgccaagcacaagtacttcaacaccaacaacctgtgggtgtcgctggaggcgctggcg
gccacccttaagtcctcgggcggcgccttggacctgccgctcatcaagaacaagaagacc
gtcaacccgcgcgacgccgccagcccgcccgtgttccagctggagacggccatggggtcc
gccatcgagtgcttcgacagcgcgggcgccatcgtggtcccgcgctcccgcttcgcgccc
gtcaagacctgctcggacctgttcgtgctgcgcagcgacgcctacgtcattgccgaggac
tccaccgtggcagtggcgcccgcgctcaagggcgccatcccgctggtgaagctggacgat
ggccactacaagctggtggaccaaatggaggcgctggcccccgccgtgcccagcctgctg
cacgccagctcgctcaccgtcaagggagctgtcaagttctcgccaggtgtggtgctcaag
ggcgaagtgacgctggaggcggagggctcgggtccggctgtgctgaccgcgggcgagtac
agcggtgcggtcaagctgggcgagccagccaaggtggcggcgtga

DBGET integrated database retrieval system