KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_160030Help
Entry
CHLREDRAFT_160030 CDS       T01039                                 

Gene name
PP1A
Definition
protein phosphatase 1 (EC:3.1.3.16)
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
cre  Chlamydomonas reinhardtii
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:cre00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    CHLREDRAFT_160030 (PP1A)
Enzymes [BR:cre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     CHLREDRAFT_160030 (PP1A)
Protein phosphatases and associated proteins [BR:cre01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     CHLREDRAFT_160030 (PP1A)
Transcription machinery [BR:cre03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     CHLREDRAFT_160030 (PP1A)
Spliceosome [BR:cre03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    CHLREDRAFT_160030 (PP1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 304 aa AA seqDB search
MDIAQVDEIIERLLDVRNGRPGKQVQLAENEIRLLCLTAKEIFMSQPNLLELEAPIKICG
DIHGQYSDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLSFKIKYPENFFLLRG
NHECASINRIYGFYDECKRRYNIRLWRTFTDCFNCLPVAALIDEKILCMHGGLSPELKSL
EQIKRITRPTDVPDSGLLCDLLWADPDKDIQGWGENDRGVSYTFGPDCVTEFLQKHDLDL
VCRAHQVVEEGYEFFAKRQLVTIFSAPNYCGEFENAGAMMSVDETLMCSFQILKPAETKA
KGRR
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggacattgctcaggtcgacgagattattgagcggcttttggacgtgcggaatggccgc
ccggggaagcaggtgcagctggcggagaatgagattcgtctgctctgcttgacggccaag
gagatctttatgagccagcccaacctgctggagctggaggcgcccatcaagatttgcggc
gacatccacgggcagtactcggacctgctgcgcctgtttgagtatggaggcttccctccg
gaggcgaactacctattcctcggcgactatgtcgaccgcggcaagcagtctctggagacc
atttgcctgctgctgtcgttcaagatcaagtacccggagaacttcttcttgttgcggggg
aaccacgagtgcgcgtccatcaaccgcatttatggcttctatgacgagtgcaagcggaga
tacaacatccgcctgtggcgcacgttcacggactgcttcaactgcctgcccgtggcggcg
ctcatagacgagaagattctctgcatgcacggcggcctgtcgcctgagctgaagtcgctg
gagcagattaagcgcatcacccggccaacggacgtgcccgactcgggcctgctgtgcgac
ctgctgtgggcggacccggataaggatatccagggctggggcgagaacgaccgtggcgtg
tcctacacgttcgggccggactgcgtcacggaattcctccaaaagcacgacctggacctg
gtgtgccgcgcgcatcaggtggtggaggaggggtacgagttcttcgcaaagcgccagctt
gtgaccatattctcggcgccgaactactgcggcgagttcgagaatgcgggagcgatgatg
agcgtggacgagacgctgatgtgctccttccagatcctgaagcccgccgagacgaaggcg
aaggggcggcgctga

DBGET integrated database retrieval system