KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_163751Help
Entry
CHLREDRAFT_163751 CDS       T01039                                 

Gene name
CBR1
Definition
NADH-cytochrome b5 reductase
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
cre  Chlamydomonas reinhardtii
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cre00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 280 aa AA seqDB search
MRSVITLLSYWQVGAGLLVVLVLIQALVFLRKKTKKPFLDPSEFQPVPLVEKTLITHNTV
RLRFALPDPEQRVGLPIGQHISFKAQGEDGKDVIRPYTPVSDDDQLGAVDFVIKLYPTGK
MSQVIAKMQLGDTMLMKGPKGRFTYTPNMVKHFGMLAGGTGITPMFQVLNAILKNPRDTT
SVTLLYGNLTEEDILLRKELDELVAMHGNRLTVYHVLNTPPVDKEWSGGSGFISSELIRT
KFPAPSSDIMTLRCGPSPMMVAMEKALTDLGYAEDKQFQF
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagcgttattacgctgctttcctactggcaagtcggcgctggactgcttgtggtg
ctagtccttattcaggctctggtgtttctccggaagaagaccaagaagccgttcctggac
cccagcgagttccagccggtccccctggttgagaagacgctaatcacgcacaacaccgtg
cgcctgcgcttcgcgctgccggatccggagcagcgcgtgggcctgcccatcggccagcac
ataagcttcaaggcgcagggcgaggatggcaaggacgtcatccggccgtacacccctgtg
tcagatgacgaccagctgggcgccgtggactttgtcatcaagctgtaccccaccggcaag
atgtcgcaggtgatcgccaagatgcagctgggtgacaccatgctgatgaaggggcccaag
ggccgtttcacctacacgcccaacatggtcaagcacttcggcatgctggctggcggcacg
ggcatcacgcccatgttccaggtgctgaacgccatcctgaagaacccgcgcgacaccacc
tccgtcacgctgctgtacggcaacctcacggaggaggacatcctgctgcgcaaggagttg
gacgagctggtggccatgcacggcaaccgcctcaccgtgtaccacgtgctcaacacgccg
cccgtagacaaggagtggtcgggcggcagcggcttcatcagctcggagctcatccgcacc
aagttcccggcgcccagctctgacatcatgacactgcgctgcggccccagccccatgatg
gtggccatggagaaggcgctcacggacctgggctacgccgaggacaagcagttccagttc
tga

DBGET integrated database retrieval system