KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_167286Help
Entry
CHLREDRAFT_167286 CDS       T01039                                 

Definition
hypothetical protein
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
cre  Chlamydomonas reinhardtii
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:cre00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CHLREDRAFT_167286
Enzymes [BR:cre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     CHLREDRAFT_167286
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1472 aa AA seqDB search
MDRAGLSCKPADEGFPSSQSVLDINGLADTPNFFQSTKFFACLDVSLAPHEVLFRSGDPS
DSGIYIVLHGTLGVFLEEPGHNMPPIHANTLRGVCLGGKGSGESVGDLDVVDGAVRTVSC
MALESGCLLVNVPRALFMDFVHSHPRALMLYLQQASSGSVTTAPASNRAGSATAAPAAAA
TAGASAPAGSSPTFNELLASAAASAAARSRGSGGVTHGPLREEPLPGSAKAGTAAATAAA
ALLANGPVCRLLPGRSQSVRRSFVLGQRACLATGWDVIDVEELAASFDHDIPAQRRGHSA
AAVRGRPAAGSLISCAAFLSSTAARCKVVALEPCRLVAFSWQVGGRVRGQTLEMLHSDRP
ALLIRLLLSAAAALGPVIRRFISLGLNRVWLESGDVAYRQGDFAECLYVVISGRLRLLHE
TSHPVTHARGAAPGGGETAAAAAMASALSGSPTDASALATLTAIKRLSGALKGTADWLAL
RPNLSRHHHVRLSRGADIQRLARWVAGKSVGVVLSGGGSRGLAHLGVLTALEDAGVPLDA
VGGTGQGAFMAALFAQGLGRSGLESAVRAYAAQLGSVRHLLSDLTLPVLSLFSGGAFDDA
VKRVFQRGAQRLEDLWLPFFCVTTNLTRGEASVRASMTIVGLLPPVWEGGQLLVDGGYMN
SMPVDVMRGLMGVDSVIVVDVEGRDDMGWRNLAPYDGGLSGWRLLWDRWCPVPRWRLSPG
GAGGAGAGGGGQPGARGQAQHHHPPQQLRYAALIHKLTAMTHAANLKRTAVEHRIDMYLR
PPGLWKATHRVGPFGIEEMPPLPAPSTPSGGGMPMPSGAAAAAMLLSAPHPPHPEQSERQ
AHTYRTHHHNQHGATSGASAANPLQPPAADGTAAGWAAREATRVAQTQQEPQQRQGPRSG
ASEEELSRLLQLVYEMTHAALTVALDHASAEAVCLHAPLLLARLVMELPPRQAAARLPGL
WCTLSRVLPRLACGGAGNRRATFGMMSQGPYWQEFRECRSEVTSLYSFYLSMLLQLKLQL
PTTAAQATAGPSEAAGFMDAAQQASYTVHILLRCSGVWPAVLAHGPPQQVASLVRTMGKA
LAAVGDTYAALQQRPQLLGAATQMVRAAMGNPVGQANFPAALAALLEQASIMLDQGMVFH
GLRGLDAAVAAAVADQHRQARNMSINDTMATEPMTLDIDWVAAVGGCPSADTAAARQQQA
LAGWALLQWMPELLRQAESDAPAAVNRVYAVSHVQDMAIRALWPVMREHLLASEGTASAS
ATASCPADATANAAGWRHFLLNDLNALGWTERLLARVANATPTADDMCKWAWLVRLGLSL
LAVSELPDGEWAATIGSVELSLQAVWEQAEAVGLHPSDTAAAAGGGAALAAAPAATAVNP
PPPVYKVPERLLTGLAAAVGDHFVMLWGGVPLVPGGEEAKNMRYSAITCTQPMPPVKRAQ
PRRRPVRRAGAFRSLTCPAGWLTGVVRRETPV
NT seq 4419 nt NT seq  +upstreamnt  +downstreamnt
atggaccgggctgggctgagctgcaagcccgccgatgagggctttccctcctcgcaaagc
gtgttggacatcaacggcctcgccgacacacccaacttcttccagtccaccaagttcttt
gcctgcctggacgtgtcgctggcgccgcatgaggtgctgttccgcagcggcgacccctcc
gacagcggcatctacatcgtgctgcacggcacactgggcgtgttcctggaggagccgggg
cacaacatgccgcccatacacgcaaacacgctcaggggcgtgtgtttgggggggaagggg
agcggcgagagtgtaggcgacctggatgtggtggacggcgccgtgcgcaccgtcagctgc
atggcgctggagagcggctgcctgctggtcaacgtgccgcgggctctgttcatggacttc
gtgcacagccacccgcgcgcgctcatgctgtacctgcagcaggcgtccagcggctctgtg
accacagcgcccgcctcgaatcgggccggctctgctacagccgcccctgcagctgctgct
acagccggcgcctcggcgccggcaggcagctcgcccaccttcaacgagctgcttgcgtcg
gcggcggcgtcggcggcggctcggtcgcgtggctccggcggcgtcacgcacggccccctg
cgggaggagcccctgccaggcagcgccaaggccggcaccgccgccgccacggcggcagcc
gcgctgcttgccaacggccctgtgtgccggctgttgccgggccgctctcagtcggtgcgg
cgctcgttcgtgctgggccagcgcgcctgcctggccacgggctgggacgtgatcgacgtg
gaggagctggcggcgtccttcgaccacgacatacccgcgcaacggcgtgggcactcagct
gccgctgtccgcgggcggcctgctgcaggcagcctgatcagctgcgccgccttcctgtcc
tccaccgccgcccgctgcaaggtggtggcgctggagccgtgcaggctggtggccttctca
tggcaggtgggcgggcgggtgcgcgggcagacgctggagatgctgcactcagaccggccc
gcgctgctgatccggctgctgctgtccgccgccgccgcgctgggccccgtcatccgccgc
ttcatcagcctgggcctcaaccgcgtgtggctggagagcggcgacgtggcgtaccggcag
ggcgactttgcggagtgcctgtatgtggtgatcagcgggcggctgcggctgttgcacgag
accagccaccccgtcacacacgcccggggagctgcacctggaggaggagagacggcggcg
gccgccgccatggcgtctgcgctgtccggctctcccaccgacgcctcggcgctggccaca
ctcaccgccatcaagcgcctcagcggggcgctcaagggcacggcggactggctggcgctg
cggcccaacctgtcgcggcaccaccacgtccgcctcagccgcggcgccgacatccagcgt
ctggcccgctgggtggccggcaagtcggtgggtgtggtgctcagcggcggcggcagtcgc
ggcctggcgcacctgggcgtgctgacggcgctggaggacgcgggcgtgccgctggacgcg
gtgggcggcaccgggcagggcgcattcatggcggcgctgttcgcgcagggcctgggccgc
tccggcctggagtcggcggtgcgcgcctacgcggcgcagctgggcagtgtgcggcacctg
ctgtccgacctcacgctacccgtgctcagcctgttcagcggcggggcgttcgacgacgcc
gtcaagcgcgtgttccagcggggcgcacagcggcttgaggacctgtggctgccgttcttc
tgcgtcaccaccaacctcacgcgcggcgaggccagcgtgcgcgcctccatgaccatcgtg
ggcctgctgccgccggtgtgggagggcgggcagctgctggtggacggaggctacatgaac
agcatgcccgtggacgtgatgcgcggcctgatgggcgtggactcggtgattgtggtggac
gtggagggccgcgacgacatgggctggcgcaacctggcgccctacgacggcggcctgtcc
ggctggaggctgctgtgggacaggtggtgccccgtgccgcgatggcgcctgtcgccgggc
ggagcaggaggagcaggagcaggaggaggcggccagccgggcgcccgaggccaggcgcag
caccaccacccgccgcagcagctgcgctacgccgcgctgatccacaagctgacggccatg
acgcacgcagccaacctgaagcgcaccgcggtggagcaccgcatcgacatgtacctgcgg
ccgccggggctgtggaaggccacgcaccgcgtggggccgttcggcattgaggagatgccg
ccgctgccggcgccctccacgccctccggcggcggcatgcccatgccctccggcgccgcc
gccgccgccatgctcctctccgcgccgcacccgccgcacccggagcagtcggagaggcag
gcgcacacgtaccgcacgcaccaccacaaccagcacggtgccacatccggcgcgtcagcg
gccaacccgctacagccgccggctgccgacggcaccgcggccggctgggcggcacgcgag
gcaacgcgcgtggcccagacgcagcaggagccgcagcaacgccagggcccgcgctccggg
gcgtcagaggaggagctctcgcggctgctgcagctggtgtacgagatgactcatgcggcc
ctgacggtggcgctggaccacgcgtccgccgaggccgtgtgccttcacgcgccattgctg
ctcgcgcgcttggtgatggagctgccgccgcgtcaggcggcggcgcgtctgccgggcctg
tggtgcacgctgtcacgtgtgctgccgcgtctggcgtgcggtggcgctggcaaccgcaga
gcaaccttcggcatgatgtcccaaggtccctactggcaagagtttagggagtgtcgatcg
gaggttacaagcctatacagcttctacctcagcatgcttctgcagctgaagctgcagctg
ccgactactgccgcacaggcgacggcggggcccagcgaggcagcaggcttcatggatgca
gcacagcaagcctcgtacacggtgcacattctgctgcgctgctctggcgtgtggccggct
gtgctggcgcatgggccgccgcagcaggtggcgtcgctggtgcgcaccatgggcaaggcg
ctggcggcagtcggcgacacgtacgctgcgctgcagcagcggccgcagctgctgggggcg
gcgacgcagatggtgcgcgcagcgatgggcaatcccgttgggcaggccaacttccctgcc
gcgctagccgcgctgctggagcaggcgtctatcatgctggaccaagggatggtcttccat
ggcctccggggcctggacgcggctgtggcggcagctgtggctgaccagcatcgacaggcg
cgaaacatgtctatcaatgacacgatggcaacggagccgatgacgctggacatcgactgg
gtcgcagccgtgggcggctgcccctccgctgacacggctgcggcgcgtcagcagcaggcg
ctagcgggctgggcgttgctgcagtggatgccggagctgttgcgacaggcggaaagcgac
gcccccgcagccgtcaaccgtgtgtacgcagtcagccatgtgcaagacatggctatcagg
gccctatggccggtgatgcgtgagcacctgctagcgagcgaagggacggcctcagcatca
gccaccgcttcctgcccggccgacgccacggcaaacgcagcgggctggcggcacttcctg
ctgaacgacctaaacgcgctgggctggacggagcgattgctggcgagggtggcaaacgca
acgccgacggcggacgacatgtgtaaatgggcctggctcgtgcggctggggctgtcgctc
ctagccgtcagcgagctgcctgacggggagtgggccgcgactataggcagtgtggagctg
tcgctgcaagcggtgtgggagcaggcggaggcagtagggcttcatcccagcgacaccgcg
gcggcggctggcggcggtgcggcattggctgccgcgcccgctgccactgctgtgaacccg
ccgccgccagtctacaaggtgccagagcggctgcttacgggccttgcagctgctgtgggc
gaccactttgtgatgctgtggggcggcgtgcccttggtaccgggcggggaagaggcgaag
aacatgaggtacagcgccatcacctgcacccagccgatgccgccggttaagagagcccag
ccccggaggcgacctgtgcggcgggcaggggcgttcaggtctctcacgtgcccggcaggc
tggctgacgggcgttgtgaggcgggagacgcccgtgtag

DBGET integrated database retrieval system