KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_168661Help
Entry
CHLREDRAFT_168661 CDS       T01039                                 

Definition
hypothetical protein
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
cre  Chlamydomonas reinhardtii
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:cre00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CHLREDRAFT_168661
Messenger RNA biogenesis [BR:cre03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     CHLREDRAFT_168661
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1130 aa AA seqDB search
MEYATLLELLQNLHSAGGVESDEILLYLQQFKEGFLKLLDFKGPSPESRRQVQSRKVTTA
KFGVQELDLVPDVQHALLLSDELRLDELLCVEYLTSALEERGVFGAEYAAGLYLEERQAI
AAYVSELLSEKDASGRQVLVSRLIAILRDTSLEPRPGTALPLVRDEAGNPVGRGLLLQRE
RRSGDLFLVEEAQLVLLAGCCVLELVTATRSKVESVGQAGYGAALRLCWGLLALVSQAAP
QDGAHWVREALKAGALAFMRQLFQHPHFKLDDVTHSHVVAAAVHHILAALLRTDAERAAG
AFYQQLLQRSEAAIRPTAGHGHGAVLAYTPFPPESPEARADQLGSLLGLLADCFEAYPDL
YLSNLADQEAGARPMDAMAAVPALEVLTLRKLFHTGGSSLLSAYESIINPYEADILVAFL
QLLKRVLCHGRPAEVAAFWAASSADLAPSLNGFPLQEPLFQLMCYPAALDEVLGALAAAL
PDLAPRLLERLLQCTVVKAPAAVLPTRAGPSVDARLPHRRPEVGAQPPPLTPNPYLFVSP
PGGGPAYAALLHVLSPGYAAALTALAGDSDEVGAREAAVLAGLRLLNAALQLDGPFVESL
AATNLSNRYQPLHQKLLSGGVRQAATLLQYVCYPDSADIQVGPYGGSPGSDSPADPRAAL
VLRLMLATSAPSLPTPSFAHLLLGYDMECALGGRLDESLLIPHQEYSCLTILERLLTQHD
MRMALTKPKLYSQCLCLLHRLAASPAAGLPMLEYLSPKNNDLGAGESPPLEQLLTNPALM
SAAGVAMASDTGDLLFSEQAILHVSLGQASDPLAAVRVPSRCQALLRLLVDLIRAAHARR
TPAVRLQLYAATLQYLQLSRGSKLATSCAPAVLAALLQGWGTPAEAVAVLDQSEELIERA
NAAVVAEAGPALVEALAADALNGSAPPLGQAVSLHLLRALLAVDSAHYGASSACAALDVV
PDDPTTSQPRPGLPGCGADGVRYRLNALAAPLLRLLLTVLAALPDSPAVRADAAAFAAAH
HGLLCRAMSDAAAAGSRGGWVPGDSELELADLGLGLLVRLVPALPSLPPLVAEPLKAAAY
KLAFQFCCLEERSASPLACHDASAALDELCELLALLRLPDSHLDEATVRA
NT seq 3393 nt NT seq  +upstreamnt  +downstreamnt
atggagtacgcgacgctgcttgagctgctccaaaatttgcactcggctggaggcgtcgag
agcgatgagatcctgctgtatctgcagcagtttaaggaggggttcttgaagctgctcgac
ttcaagggcccctcgccggagtcgcggcgccaggtgcagtcgcgcaaggtcaccactgcc
aagttcggggtccaggagcttgacctggtaccggacgtgcagcatgctctgctgctgagt
gacgagctgcggctggatgagctgctgtgtgtggagtacctcacctcggccctggaggag
cgcggagtgttcggagccgagtacgcggccgggctgtacctggaggagcggcaggctatc
gccgcctacgtgagcgagctgttgagcgagaaagacgccagcggccggcaggtgctggtg
tcgcgactcatcgccatcctgcgggacacctcgctggagccgcggccgggcacggcgctg
ccgctggtccgcgacgaggccggcaacccggtgggccgcggcctgctgctgcagcgcgag
cggcgctcgggcgacctgttcctggtggaggaggcgcagctggtgctgctggcgggttgc
tgcgtgctggagctggtgacggccacccgcagcaaggtcgagtcggtgggccaggcgggc
tacggcgctgcgctgcggctgtgctgggggctgctggcgctggtgagccaggcggcgccg
caggacggtgcgcactgggtgcgggaggcgctcaaggcgggcgcgctggccttcatgcgg
cagctgttccagcacccgcacttcaagctggacgacgtcacgcactcgcacgtggtggcg
gcggccgtgcaccacatcctggcagcgctgctcaggacggacgcggagcgggccgccggc
gccttctaccagcagctgctgcagcgctccgaggccgccatccggcccaccgccggccac
ggccacggagccgtgctggcctacacgcccttcccgcccgagtcacccgaggcgcgcgcc
gaccagctgggctcgctgctggggctgctggcggactgcttcgaggcctacccggatctg
tacctgtccaacctggcggaccaggaggcgggcgcgcggcctatggacgccatggcagcg
gtgccggcgctggaggtgctgacgctgcgcaagctgttccacacgggcggctcctcgctt
ctgtccgcctacgagtccatcatcaacccctacgaggccgacatcctggtggccttcctg
cagctgctcaagcgtgtgctgtgccacgggcggcccgccgaggtagccgccttctgggcc
gcctcctccgccgacctggcgccctcgctcaacggcttcccgctgcaggagccgctgttc
cagctcatgtgctacccggccgcgctggacgaggtgctgggcgcgctggcggcggcgctg
cccgacctggcgccgcgcctgctggagcggctgctgcagtgcaccgtggtcaaggcgccc
gcggcggtgctgcccacacgtgctgggccatctgtggacgcgcggctaccgcatcgccgc
ccagaagtgggagcccaacctccaccgctcacacccaacccctacctgtttgtctcgcca
ccaggcggcggccccgcctatgcggcgctgctgcacgtgctgagccccggctacgcggcg
gcgctgacggcgctggcgggagacagcgacgaggtgggtgcgcgcgaggcggcggtgctg
gcgggtctgcggctgctgaacgcggctctgcagctggacggcccctttgtggagtccctg
gcggccaccaacctcagcaacaggtaccagccgctgcaccagaagctgctgtcgggcggc
gtgcggcaggcggccacgctgctgcagtacgtgtgctaccccgacagcgcagacatacag
gtgggcccctatggcggctcgcccggctccgactcgcccgccgacccccgcgcggcgctg
gtgctgcggctgatgctggccaccagcgcccccagcctgcccactccctccttcgcgcac
cttctcctgggctacgacatggagtgcgctctgggcgggcgactggacgagtctctgctc
atcccgcaccaggagtactcctgcctcaccatactggagcgcctgctcacacagcacgac
atgaggatggcgctcaccaagcccaagctgtacagccagtgcctgtgcctgctgcaccgc
ctggccgcatcgcccgcggcggggctgcccatgctcgagtacctcagccccaagaacaac
gacctgggcgcaggcgagtcgccgcccctggaacagctgctcacaaaccccgcgctcatg
tcggcggcaggcgtggccatggcctcagacacgggcgacctgctctttagcgagcaggcc
atcctgcacgtgagcctgggccaggcctccgacccgctggcggcggtgcgggtgcccagc
cgctgccaggcgctgctgcggctgctggtggacttgatcagggcggcgcacgcacgccgc
acacccgcggtcaggctgcagctgtacgctgccacgctgcagtacctgcagctgtcgcgc
ggctccaagctcgccaccagctgcgcccccgccgtgctggcggcgctgctgcagggctgg
ggcacgcccgcagaggccgtggcggtgctggaccagtctgaggagctgatcgagcgcgcc
aacgcggcggtggtggcggaggccgggcccgcgctcgtggaggccctggcggcggacgcg
ctcaacggctccgcgccgccgctgggccaggctgtgtcgctgcacctcctccgtgccctc
ctcgccgtggactcggcgcactacggcgcctcctccgcgtgtgcggcgctggacgtggtc
cccgacgaccccacaacctcgcagccgcgccccggcctgcccggctgcggcgccgacggc
gtgcgctaccggctgaatgcgctggcggcgccgctgctgcggctgctgctgacggtgctg
gcggctctgccggactcgccggcggtgcgtgcggacgcggcggccttcgcggccgcgcac
cacgggctgttgtgtcgggccatgagcgatgcggcggccgcaggctcccgcggcggctgg
gtcccgggcgactcagagctggagctggcggacctgggcctaggcctactggtgcggctg
gtgccggcgctgcccagcctgccgccgctggtggcggagccgctcaaggccgccgcctac
aaactggcgttccagttctgctgcctggaggagcgctccgcctcgccgctggcctgccac
gacgcctccgccgcgctggacgagctgtgcgagttgctggcgctgctgcgcctgcccgac
tcccacctggacgaggccacagtgcgggcctga

DBGET integrated database retrieval system