KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_170004Help
Entry
CHLREDRAFT_170004 CDS       T01039                                 

Gene name
EIF3X
Definition
hypothetical translation initiation factor
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
cre  Chlamydomonas reinhardtii
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:cre00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CHLREDRAFT_170004 (EIF3X)
Translation factors [BR:cre03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    CHLREDRAFT_170004 (EIF3X)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 193 aa AA seqDB search
MADDLDDWETADIESTLSKPAPAPAKPAQTFETKGEAIRAKINGPDMSQFEDEDANFSAP
VEHSVPAPQPKKKEEKKFREERINPDDVPLDDPVLEKLRQQKLVEQADYEAARELFGGVS
TLKPLESYMPKTLKEFEDFAAELVSRHVVEHGESKHYKAFIKALIKAAVEPLGSEEVKDL
ETCLAGVRADKIK
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggctgacgatctagatgattgggagacggctgacattgagtcaaccctctccaagccg
gcgccagctcctgccaagccggcgcaaacctttgagacaaagggcgaggccatccgcgca
aagatcaatggcccggacatgtcccagttcgaggacgaggacgccaacttctccgcgccc
gtggagcacagcgtgcccgcgccgcagcccaagaagaaggaggagaagaagtttcgggaa
gagcgcatcaaccccgacgacgtgcctctcgacgaccctgtgctggagaagcttcgccag
cagaagctggtagagcaggcggactacgaggccgcgcgggagctgttcggcggcgtgtcc
actctgaagcccctggagagctacatgcccaagacgctcaaggagtttgaggacttcgcc
gctgagctggtgtcccgccacgtggtcgagcacggggagagcaagcactacaaggcgttc
attaaggcgctcatcaaggcggcagtggagccgctggggtcagaggaagtcaaggacctg
gagacctgcctggcgggcgtgcgcgctgacaagatcaag

DBGET integrated database retrieval system