KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_170595Help
Entry
CHLREDRAFT_170595 CDS       T01039                                 

Definition
histone acetyltransferase, type b catalytic subunit
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
cre  Chlamydomonas reinhardtii
Brite
Enzymes [BR:cre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CHLREDRAFT_170595
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 444 aa AA seqDB search
MLDHGDAPYSALHCPNQHATLRRSLWSSSAAGLYGLSAAPAPSAGAGASVGATDGASATQ
AGSQQPLEVSVRRFQLLTAPPEVKALHARLEPLLLFTIDGANFIDGDDPQWELLLPVVRA
PDGGCLVLGLTTLFNFWAYPASCRLRVSQVLVLSPWQGLGLGKALLKLSYDLAIARGCAD
LTVEDPTPNLQRVREKLEVEMLRRLDWVTAQANKCLDAAARGETTWPAGSEPSEQQQQQP
ASAGAPEAAAAPGQPASEGPQQQPEAQQQHAGAQQPSLLSTHAFFGALGVEPPERSSVPS
SVLAEATAFAEARWRQRLQDAETEAAAAATAMAVDAGAAPDGVGAGAIAADSAAGTSSAT
AAASNGAAGPSGSGAAGAPVCGALVPSPAFINAITRAIKMHRGQVRVVWEALLWSQPGAL
QRPRVRAAVEDLVSRRLESQHFSS
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgctagaccacggcgacgccccttactctgcgctgcactgcccgaaccaacatgccacc
ctcaggaggagtttgtggagcagcagcgccgccgggctgtacggcctcagcgccgcgcca
gcgcccagtgcgggtgcgggtgcgagcgtaggggctacggacggagcgtcagccacgcag
gcggggtcgcagcagccgctggaggtgtcggtgcggcggttccagctgctcacggcgccg
ccggaggtcaaggccctgcacgcccgtctggagccgctgttgctgttcaccatcgacggc
gccaacttcatcgacggcgacgacccgcagtgggagctgctgctgccagtggtgcgcgcg
ccggacggcggctgcctggtgctgggcctgaccacgctgttcaacttctgggcctacccg
gcctcctgccggctgcgcgtcagccaggtactggtgctcagcccctggcagggcctgggt
ctgggcaaggcgctgctgaagctgtcgtacgacctggccatagcccgtggctgcgccgac
ctcacggtggaggaccccacgcccaacctgcagcgggtgcgtgagaagctagaggtggag
atgctgcggcgactggactgggtgacggcacaggccaacaagtgcctggacgcggcggcg
cggggtgagaccacgtggccggccgggtcggagccgtcggagcagcagcagcagcagccg
gcgtcagctggggccccagaggccgcggcggcgccagggcagccggcctccgaggggccc
cagcagcagccggaggctcagcagcagcacgcgggcgcgcagcagccctcgctactgtcg
acacacgccttcttcggtgcgctgggtgtggagccgccagagcgctcctcggtgccgagc
tcggtgctggcggaggcgactgccttcgctgaggcgcgctggcgtcagcggctccaagat
gccgagaccgaggccgctgctgctgccacggcgatggctgttgacgcaggcgcggcgcct
gatggtgttggtgccggtgccatcgccgctgacagcgctgcagggacgagtagcgccact
gctgccgctagcaacggcgcggcgggtccaagcggctcgggcgcagcgggcgcgcctgtg
tgcggcgcgctggtgcctagcccggccttcatcaacgcgatcacaagggcgatcaagatg
caccgggggcaggtccgcgtggtgtgggaggcgctgttgtggagccagccgggggcgctg
cagcggccgcgtgtgcgggccgcggtggaggacctggtcagccgccgcctggagtcccaa
cacttctcctca

DBGET integrated database retrieval system