KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_171763Help
Entry
CHLREDRAFT_171763 CDS       T01039                                 

Definition
hypothetical protein
Orthology
K11858  
ubiquitin carboxyl-terminal hydrolase 48 [EC:3.4.19.12]
Organism
cre  Chlamydomonas reinhardtii
Brite
Enzymes [BR:cre01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CHLREDRAFT_171763
Peptidases [BR:cre01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CHLREDRAFT_171763
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 2402 aa AA seqDB search
MPRPAKGKRGKGAGAVGGHDAADLLERLNSSGLGEKEVLAIVGANKVPCEHLRSPCVRNR
KENVACFCQLVPAETSYRKKGLWQKEQTYLGTLGSDPKERQREDAATPAGLRNLGNTCYA
NAALQCLFSIPSLRTGIYTAEPAVAGHDILRQLQGLFLQMQFGPQRSVDTEALAKTLGLN
HADGQEFLKLLLTRVEQLMSKSSDGAARRLVPQLFRGGLSYVTTCQRCGRDSSSSHEVQD
FYDLMPQVRGFGSLTTSLASFLHAESLSGDNRYLCDFCGTKVDALRRVRLRALPPYLCLA
LQRFYFDPRTFDKAKALDKFAFPLTLDFSQGSPLYELVGILIHKGSQAHSGHYVAHIKDQ
ASGQWWRFDDEVAACIGPDPAAAFQSDHGAQEDEGLRFAMEASMADAAGLGSDEAGDDLK
GSVHNSPKSGPAAAAAIKGETIGKAGGVGGSGSLVSANAYMLVYRAVGLQEPPPARTVEE
LPAALQAAVAEVAAAYADECDVYQRQRDALKTQVEERRRSVRELLSCISPRLPLQTSSQQ
PLQQQQPEVIGDDEDSADASAPQEQQQQQPGTAGYWVSMPWLEHRAGARGGAAAGAAGGA
GDSQSQGGGGGAGTGSCLDPAKVAAAKLVSAEAWERLHAAHGGGPVLAAGDVCRQCLEGS
ASQALLGNQAEEAEWEEAEVEEAMDAEEDASPRSFWVSRLWLQGWSKRQGASVKAEKSPT
ADLACPHGELQPARAAKRDDAPGLAASGKAGKRETVEIDQDDRVIGDDDDDEDDMQMIDA
PSAQAGGAPAGAAPEAAGAGGLREDEDGSANRRSREASAVPPSREGTADVEAPVPPSELG
AAADAAAGKPAATAAAAAAPARIPTAAELEAMCPELPVGRVFECELCREAAGQAASAHAD
SRRQLDMERNALSGLKMEAWPQLTPGCQYYMVPTSWVREWQQYVRVLPKGTPAAPRPSSL
SAAMLRVLCPCHPDEPRLGVPPPRLTVSKRSRLSQLDLEQDPMRLITQEDWDHLRHVYLR
DLNNASSAAAADAYAVAGTSTGTVGGRDVGGGKRRAFQRASAAIANGAHGAEDGDAGAGY
AVGSNGNGRALLQEDGAADVVVKDGADGSSGAAANAAQLAAVAHGFTADVAQLGRAAREA
ALVYSEAEVMVELVAAEDLEGAFKDSGVGLERRSRRTRKGRTSITVSNTTTLEQLKLQIF
ESLSIHPKNQTLYVRGDDGSPRQLQGDELSLAQHEVLPGAELRLVRLRLVDDDDDVAGLF
GEGRAKRRQVEEGFKNTALHGDLPLQQQEAAAGAEQGADQGSSGAAGVQEAVEDDSHVRR
LSSNCYEQTSTSGQSQKGFMNWGWLKGSGKQSKRLVPGNQVAAEPVPSNRLRAAGRDGSI
NTAELLQRRGFPVHYAKDIHKSVSTSTTKPIAVLGLEPSSDGGGEGGGVAMEAKPSADGS
PDSLSRRNHNKLFPLYVNGVAKSYFKISASRDYAQVLRRLLRRDPLLTFALQKAIRNLSM
GDCKPVSHVTSDPTGASASLYGLRITPCVWSDTNGHKLPALLLEHNVPYDASDVMPRLLR
DYAVLSHVPSILTLIDFNGHVLYQNAASIDYCGDLTSHNVETGDGMLGVLFQYEPQMLQE
MLQEVNEGNYWQQVVRVPSSLKRHMIFETESSWGHGSRGHDRKKLNVAVSKRFIQDALEP
EFQLESFTTQNARSQRNNARTGRAAFQQQPSLMRQESARHPQRQDTRDSGVAIAGPAALP
VGRMASITGAAPRLGSHTLGPGASHVVFNLPNQLEDGHSSNHITHGGSFSTGISKASAPT
QHSHLTNQGQNRRFMTLMQSAAERQQQPSFTGSMNSFHTEGEKPDSRQGGPVQEECWHDI
SAIPLLDPVLDKQVILLLQTNVTARVELENRLADLTDAQLGMLEQLFPRHVIEYMLSHKH
GYNSRNLTHLANHHDDVIVLFTDVVGFTSMSKEVEPSEVMHFLNELYTIFDDLVDLHDLY
KLDTVGDCYIVVAGLTMQDDDGFTCTVQGDNEQRLQHAQVMMDFAKAILRESKQVLMPHN
HAPVQIRIGIHTGSLASGLVGPKMPKFTLFGDTMNTASRMESTCKPGCVQVSELFAQLLP
LEDWEDTGGVEVKGKGHMQTYLWTPKPEDLIPLGSSRPKSSRYVRPTTARMRESQNGGVH
SRPSTASSHGGLTRAPSARLGRSLSRRNVSFRFHGGDEGGEGDEAGGAGSTPFMAILNAI
RGSGTGEGDEGTDDELEGVPRRQREPSMPMRRPSNNVSLNGGAGPTGSGSLSGPQLSLTG
GLASGSGGSRQGTLSGGLQPGSRAGTAGGPLANSSGSGALQATSSGLGGGGSRVGTASGG
QPSVVQHVDLDEAMDVLKPSPSNRPSDSSKPLKAVRLSLTPEAAGGPPPRPSQNGAPVRT
AK
NT seq 7209 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgtcccgcgaaaggcaaacgcggcaagggagcgggtgcggtcgggggccatgac
gcggccgatcttcttgaacggctcaacagcagcggccttggtgaaaaagaggtgcttgcg
attgtaggggccaacaaggtgccctgcgaacacctccggagcccttgcgtgaggaaccgg
aaggagaatgtggcatgcttctgtcagctcgtgcctgccgagacgtcgtaccgcaaaaag
gggctgtggcaaaaggagcagacgtacctagggacgctggggtcggaccccaaggagagg
cagcgagaggacgcggccacgcccgccgggctgcgcaacctgggcaacacctgctacgcc
aacgcggcgctgcagtgcctgttctccatcccctcgctacgcaccggcatctacaccgcg
gagccggcggtggcgggccacgacatcctgcgccagctgcagggcctgttcctgcagatg
cagttcgggccgcagcggtcggtggacacggaggcgctggccaagacgttgggcctcaac
cacgccgatggtcaggagttcttgaagctgctgctcacgcgcgtggagcagctgatgagc
aagtctagcgacggggcggcacggcggctggttcctcagctgttccgtggcggtctgtcc
tacgtcaccacctgccagcgctgcgggcgtgactcgagcagctctcacgaggtgcaggac
ttttacgacctcatgccccaggtccgcggctttggctcgctcactaccagcctggcatcc
ttcctgcacgccgagtcgctcagcggtgacaaccgctacctgtgcgacttctgcggcacc
aaggtggacgcgctgcgccgcgtgcggctgcgcgcgctgccgccctacctgtgccttgcg
ctgcagcgcttctattttgacccccggactttcgacaaggccaaggctctggacaagttc
gccttcccgctgacgctggacttcagccagggcagccccctgtacgagctggttggcatc
ctcatccacaagggctcgcaggcgcacagcggacactacgtcgcgcacatcaaggaccag
gccagcgggcagtggtggcgctttgacgacgaggtggctgcctgcattggccccgacccc
gccgccgccttccagtcagaccacggcgcgcaggaggacgaggggctgcggtttgccatg
gaggctagcatggccgacgcggccgggctcgggtccgacgaggcgggcgatgacctgaag
ggctcggtgcacaacagccccaagtccggccccgctgccgccgccgcaatcaagggcgaa
acaatcggcaaggctggtggcgtgggcggcagcggctcgctggtgtccgccaacgcctac
atgctggtgtaccgggccgtggggctgcaggagccgccgccggcccgcaccgtggaggag
ctgccggcggcgctgcaggcggccgtggccgaggtggcggcggcctacgcggacgagtgc
gacgtgtaccagcggcagcgcgacgcgctcaagacgcaagtggaagagcggcggcgctcc
gtgcgtgagctactcagctgcatcagcccgcggctgccgctgcagacctcgagtcagcag
ccgctgcagcaacagcagccggaggtcattggagacgacgaagactcggctgatgcctcg
gcgccccaggagcaacagcagcagcagcccggcacagcggggtactgggtgtcaatgcct
tggcttgagcaccgagcaggcgcgcgcggaggtgctgctgccggggcagcaggcggcgcg
ggggacagtcaaagccaaggtggaggaggcggggccggcactgggagctgcttggaccct
gccaaggttgcggctgccaagttggtatcggccgaggcctgggagcgtcttcacgcggcg
cacggcggcgggccggtgcttgcggcgggcgacgtgtgccggcagtgccttgagggcagc
gccagccaggcactgctcggcaaccaggcggaggaggcagagtgggaggaggctgaggta
gaggaggcgatggacgcggaggaggacgcctcgccgcgctcgttctgggtgtcacgcctg
tggctgcagggctggtccaaacgccagggcgccagcgtcaaggccgagaagtcgcccacc
gccgacctggcctgcccgcacggcgagctgcagccggcgcgcgccgccaagcgggatgac
gcgccggggctggcggcgagcgggaaggccgggaagcgcgagacggtggagatcgatcag
gatgaccgcgtcatcggtgacgacgacgacgacgaggatgatatgcagatgattgatgcg
ccgtcggcgcaggctggtggcgcgccggcgggggctgcacctgaggcagctggggccgga
ggcctgcgcgaggacgaagacggctcggcaaacaggcgctcgcgtgaggcgtccgcggtg
ccgccgtcccgggagggcaccgcagacgtggaggcgccagtgccgccgtcggagctgggc
gccgccgcagacgcagcggccggcaaaccggcggctacggctgccgccgccgcagcgcct
gcgcgcataccgacggcggcggagctggaggccatgtgtccggagctgccggtggggcgc
gtgttcgagtgcgagctgtgccgcgaggcggcggggcaggcggcgtcggcgcacgcggac
agccggcggcagctcgacatggagcgcaacgcgctgagcggcctcaagatggaggcctgg
ccgcagctgacgcccggctgccagtactacatggtgcccacgtcctgggtccgggagtgg
cagcagtacgtgcgcgtgctgcccaagggaacgccggcggcgccgcggcctagctccctg
tccgccgccatgctgcgcgtgctgtgcccctgccacccggacgagccacgccttggcgtg
ccgcccccgcgcctgactgtcagcaagcgcagccggctctcgcagctggatctggagcag
gaccccatgcgcctcatcacccaggaagactgggaccacctgcgccacgtctacctgcgc
gacctcaacaacgcctcgtccgccgcagcagccgacgcttacgcggtcgcaggcacgagc
acaggcacagtaggcggacgtgacgtgggcggcggcaagcgccgcgctttccagcgcgcc
agcgccgccatcgcaaacggcgcgcacggtgccgaggatggcgacgccggcgcgggctat
gccgtcgggtcaaacggtaacggcagagcgctgctgcaggaggacggcgccgccgatgtg
gtcgtgaaggacggggccgatggaagcagcggcgcggcggcgaacgcagcccagctggcg
gcggttgcgcacggcttcaccgctgacgtcgcacagctgggccgagcggcgcgcgaggcg
gcgctggtgtattcggaggccgaggtgatggtggagctggtggcggctgaggacctggag
ggcgcgttcaaggatagcggtgtcggacttgagcggcgctcacggcgcacccgcaagggc
cgcacctccatcaccgtcagcaataccaccaccctggagcagctcaagctacagatcttc
gagagcctgtccatccaccccaagaaccagacgctatacgtccgcggcgacgacggctcg
ccgcggcagctgcagggcgatgagctgagtctggcgcagcacgaggtgctaccgggcgcg
gagctgcggctggtgcggctgcggctggtggacgacgacgacgacgtggctgggctgttc
ggcgagggccgggccaagcggcggcaggtggaggagggcttcaagaacactgccttgcat
ggggacctgccgctgcagcagcaggaggcagcggcaggcgccgagcagggcgccgatcaa
ggcagcagtggggctgctggagtgcaggaggcagttgaggacgactcgcatgtgcggcga
ttgtctagcaactgctacgagcagacctccacgtcggggcagtctcaaaaaggcttcatg
aactggggttggctcaagggctcagggaagcagtcgaagcgcctggtgcctggtaaccag
gtcgctgcggagccggtgccttcgaaccgcttgcgagcggccggccgcgatggctccatc
aacactgcagagctgttgcaacgccgcggcttccctgtgcactacgccaaggacatccac
aaatcagtttcaacgtccacgacgaagccgatcgcggtgctgggcttggagccctctagc
gacggagggggcgaggggggaggcgtggcgatggaggcaaaaccgtccgcggacggctcg
ccggactcgttgtcccgtcgaaaccacaacaagctgttccctctctacgtcaacggcgtg
gcgaagtcttatttcaagattagcgccagccgggactatgctcaggtgctgcgacgtctc
cttcggagggacccgctgctcacgttcgcgctgcagaaggccatccggaatctctcgatg
ggcgactgcaagccggtcagccacgtcacttcggaccccacgggcgcgtccgcgtcgctc
tacgggctgcgcattacgccctgcgtttggtcggacaccaatgggcacaagctgccggcg
ctattgctggagcacaacgttccctatgacgcctccgacgtgatgccgcgcctgctgcgc
gactacgcggtgctgtcgcacgtcccctccatcctcacgctcatcgacttcaacggacac
gtcttgtatcagaacgccgcaagcatagactactgtggcgacctcaccagtcacaacgtg
gagacgggcgacgggatgctgggcgtgctcttccagtatgagccgcagatgctgcaagaa
atgttgcaggaggtcaacgagggcaactactggcagcaggttgtccgggtgccatcgtcg
ctgaagcggcacatgatattcgagacggagagcagctggggtcacggcagtcgcggccat
gaccggaagaagctcaacgtcgcggtgtctaaacgcttcatccaggatgcgcttgaaccg
gagttccagctggagagctttacgacgcagaacgcgcgtagccagcggaataacgcgagg
actgggcgggcggcgttccagcagcagcccagcttgatgcggcaagagagcgcgcggcac
ccgcagcggcaggacacgcgcgacagcggcgtggccattgctgggcctgcagcactaccg
gtggggcggatggctagcattacgggggcggcaccgcggctgggcagtcacacgctcggg
ccgggggcgtcgcacgtggtgttcaacctgcccaaccagttggaggacgggcacagcagc
aaccacatcacgcacggcggctcgttctccacgggcatcagcaaagccagtgcgcccacg
cagcattcgcacctgacgaatcaggggcagaaccggcgcttcatgacgctaatgcagtcg
gcggcggagcggcagcagcagcccagtttcaccggctcgatgaacagcttccacacggag
ggtgagaagccggactcgcggcagggcgggccggtgcaggaggagtgctggcacgacatc
tcggccatcccccttttggacccggtgctggacaagcaggtgatccttttgctccaaacg
aacgtcactgcgcgcgtggagctggagaaccgcctggcggatctgacggacgcacagctt
ggtatgcttgagcagctgttcccacggcacgtgattgagtacatgctctctcacaagcac
ggctacaattcgcggaatctgacgcacttggccaaccaccacgacgatgttatcgtgctg
ttcacggacgtggtgggctttacgtcgatgagcaaggaggtggagcccagcgaggtgatg
cacttcctcaacgagctgtacaccattttcgacgacctcgtggacctgcacgacctgtac
aaactggacaccgtgggcgactgctacatcgtggtggcgggcctcaccatgcaggacgac
gacggcttcacgtgcacggtgcagggcgacaacgagcagcggctgcagcacgcgcaggtc
atgatggactttgcaaaagccatcctgcgcgagtcgaagcaggtgctcatgccgcacaat
cacgcgccggtgcaaatccgcatcggcatccacacgggcagcttggcgagcgggctggtc
gggccgaaaatgcccaaattcacgctgtttggcgacaccatgaacacggcttcccgcatg
gagagcacgtgcaagccaggctgcgtgcaggtctcggagctgtttgcgcagctgctgccg
ctggaggactgggaggacacgggcggtgtggaggtgaaagggaagggccacatgcagacg
tacctgtggacacccaagccggaggacctcattcctctcggcagcagccggcccaagagc
agccgctatgtacggccaacgaccgcgcggatgcgggagagccagaacggtggtgtgcac
agccggccgagcacagccagcagccacggcgggctcacgcgggcgccctcggcgcgcttg
ggccgctcgctgtcgcggcgaaacgtcagctttcgcttccacggcggggacgaggggggc
gagggggacgaggcgggcggcgccggcagtacgccgttcatggcgatcctgaacgcaatc
cgcggcagcggcacgggcgagggcgacgagggcacggacgacgagctggagggcgtgccg
cggcggcagcgggaaccatcgatgccgatgcggcggcccagcaataacgtaagcctgaac
ggtggcgcggggccgacaggcagcggctcgctcagtgggccccaactctcgttgactggc
ggtctggccagcggcagcggcggcagccgacagggcaccctaagcggcggcctgcagccg
ggcagccgggctggaactgccggtggcccgttggctaactcatccggcagcggcgctctg
caagcgaccagcagcggtttaggtggcggcgggagccgggtgggtacggccagcggcggg
cagcctagcgttgtgcagcacgtggacctagatgaggccatggacgtgctcaaacctagc
ccctccaaccggccatcggattcatccaagccgttgaaggccgtgcggctgtcgctgacg
ccagaagcggcgggcgggccacctccgcggccatcgcagaacggcgcgcctgtgcggacc
gccaagtaa

DBGET integrated database retrieval system