KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_173725Help
Entry
CHLREDRAFT_173725 CDS       T01039                                 

Definition
alpha-amylase-like protein (EC:3.2.1.1)
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
cre  Chlamydomonas reinhardtii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cre00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CHLREDRAFT_173725
Enzymes [BR:cre01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     CHLREDRAFT_173725
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 404 aa AA seqDB search
MPPPPPTSVPFLQLTTCRLAASAPTSPQTSHTPLNSHTHVTMALGMHAQQQQHRLQARTA
NRRTAAAPLRPAQPANAAASRSRAQRGFAWDSWQKGGGNWYGRVQAAIPELAALQVSHVW
LPPPSRSVSKEGYLPGQLYDLDSEYGTKEQLTQLCAALKAAGISPMADIVINHRANDPHF
NGEGNPDTGDDFGAAPDLDHANPELRAALVDWLKHLKTEVGFTGWRFDYARGYAARFIAE
YVDKTVGKDVLNVGEYWTEQWQGKAPGLVGWWPAKAVTFIENHDTGSTQQHWPFPSEYVG
TGYAYLLTHPGIPTIFWDHVFEWGEPLRQEITALAQLRQRVGLHSESKLEILAAEPDMYV
ARVAEKVTVKLGPRCDMGDLLPKEDDGWKFVMSGKDWAVWEKTN
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgcccccccccccccccacctcagtgcccttcctccaactgacaacctgtcgccttgct
gcctctgcccctacttccccacagacttctcacacgcccctcaactcacacacccacgtg
accatggcgctaggcatgcatgcgcagcagcagcagcaccgcctgcaggcccgcacagcc
aaccgccgcacggccgctgcgcccctgcggcctgcccagcccgccaacgctgccgccagc
cgcagccgcgcgcagcggggcttcgcctgggacagctggcagaagggtggcggcaactgg
tacgggcgggtgcaggccgccatccccgagctggcggcgctgcaggtgagccacgtgtgg
ctgccgccgcccagccgcagcgtgtccaaggagggctacctgcccggccagctgtacgac
ctggacagcgagtacggcaccaaggagcagctgacccagctgtgtgcggcgctcaaggcg
gcgggcatcagccccatggcggacatcgtcatcaaccaccgggcaaacgacccgcacttc
aacggcgagggcaaccccgacacgggcgacgacttcggcgccgcgcccgacctcgaccac
gccaaccccgagctgcgggctgcgctggtggactggctcaagcacctcaagacggaggtg
ggcttcaccggctggcgcttcgactacgcgcgcggctacgccgcgcgcttcattgccgag
tacgtggacaagacggtgggcaaggacgtgttgaacgtgggcgagtactggacagagcaa
tggcagggcaaggcgccggggctggtgggctggtggccggccaaggcggtgacgttcatt
gagaaccacgacacgggcagcacgcagcagcactggcccttcccctccgagtacgtgggc
accggctacgcttacctgctcacacacccgggcatccccaccatcttctgggaccacgtg
ttcgagtggggcgagccgctgcgtcaggagatcaccgccctcgcgcagctgaggcagcgt
gtcggcctgcactccgagagcaagctggagatcctggcggcggagcccgacatgtacgtg
gcgcgcgtcgcagagaaggtgactgtgaagctgggtcctcgctgcgacatgggcgacctg
ctacccaaggaggatgacggctggaagttcgtgatgagcggcaaggactgggcggtgtgg
gagaagaccaactga

DBGET integrated database retrieval system