KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_176233Help
Entry
CHLREDRAFT_176233 CDS       T01039                                 

Gene name
CYC
Definition
mitochondrial cytochrome c
Orthology
K08738  
cytochrome c
Organism
cre  Chlamydomonas reinhardtii
Pathway
Sulfur metabolism
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:cre00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 112 aa AA seqDB search
MSTFAEAPAGDLARGEKIFKTKCAQCHVAEKGGGHKQGPNLGGLFGRVSGTAAGFAYSKA
NKEAAVTWGESTLYEYLLNPKKYMPGNKMVFAGLKKPEERADLIAYLKQATA
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaccttcgctgaggcccccgctggcgaccttgctcgcggcgagaagattttcaag
accaagtgcgcgcaatgccacgttgctgagaagggcggcggccacaagcagggccccaac
ctgggcggtctgttcggccgtgtctcgggcactgctgccggcttcgcatactcgaaggcg
aacaaggaggctgccgtgacctggggcgagagcactctctacgagtacctgctgaacccc
aagaagtacatgcctggcaacaagatggtgttcgctggcctgaagaagcccgaggagcgc
gccgatctgattgcctacctgaagcaggcgactgcttaa

DBGET integrated database retrieval system