KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_176480Help
Entry
CHLREDRAFT_176480 CDS       T01039                                 

Gene name
TOR1
Definition
target of rapamycin, growth-regulatory PI3K-like protein kinase
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
cre  Chlamydomonas reinhardtii
Brite
Protein kinases [BR:cre01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   CHLREDRAFT_176480 (TOR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1696 aa AA seqDB search
MMLSGVGPVPTKPAFKAGGDTLSRHLEELCRSGAWERRHKDGDKALLEYIEAEARDLSVE
AFGRLMTDVYQRIGNMLLKGNDITRRMGGVLAIDELIDVKLSGDDAAKTARLSGLLSRVL
EESEDPVLSESASHTLGHLVRSGGAMTSDIVEKEIRRSLAWCDPRNEPNESRRLTALLVL
TEAAESAPAVFNVHVKSFIDAVWFPLRDAKQHIREAAVRALKACLCLVEKRETRYRVQWY
YKLHEQTMRGMKRDHRTGALPSPESIHGSLLALAELLQHTGEFMLARYKEVVENVFRYKD
SKEKNIRRAVIHLLPRMAAFSPERFASEYLARAIAFLLIVLKNPPERGAAFAALADMAAA
LARVNCAAGVSEVLVQALTQVANALPELLEDIQYQLLDLLSLVLSKRPFNSSTTQPKFAA
LSAAIAAGELQGNALTKLALQTLGTFDLGGIQLLEFMRDHILAYTDDPDKEIRQAAADCL
RALFVGMNDESVAVRGLAIRLVGRLAERNPAHVNPALRKHLLQLLHDMEFSPDNRAREES
AFLLEVLITAAARLIMPYVSPIQKALAKAAALQRDLVNENNVIKTVLSTLGALAEVSGTT
FRPFISEVMPLVIEAIQDNSDGRRRVVAVKTLGFIVSSCGNVMGPYLEYPQLLSVLLRML
HEGHPAQRREVIKVLGIIGPGDDGGPGGDLLPSSGLVTSSEDYYPTVAINALMRVLRDPA
LASQHLAVIRALAAIFRALQLSVVLPILLGVLRGGDEALREEILASLRALVGYVRQHMRR
FLPDLTQLVHEFWPAAPRTCLALIADLGMALRDDIRCVLDGHSDEQLRRDALDTICAVAV
CLGPEFAIFVPTIRKACQRHRLHHEWFDRLAGKSSHRVTKEDWAEWMRNFAVELLKESPS
PALRACHGLAQVHPSMARELFAAGFVSCWAELEQGLQEQLVRSLEAALASPTIPPETVTA
LLNLAEFMEHDDKRLPLDTRTLGALAEKCHAFAKALHYKELEFQTSPQSAIEALIHINNQ
LRQPEAAVGVLAYAQKHLHMELKEGWYEKLCRWDEALDAYERRLLKEAPGSMEYHTLLRY
NPMNITQAGNPGYGAGSGAPHVMLAFLKHLWTQGNRTEAYNRIKDLEASRLYFGESNVEG
MLNTLLPLHEMLEKAGPTTLKEIAFVQSYGRELSEAYEWLMKYKASRKEAELHQAWDLYY
HVFKRINKQLHSLTTLELQYVSPALVRAQKLDNPGVIAENLASFRAATEHAPNWAKAWHQ
WALFNVAVSAHYSVALGQAAGDRTGNLQDILRLLTLWFNFGAYAEVRAALTEGFQLVSID
TWLLVIPQIIARIHTHNTDVRQLIHHLLVKIGRHHPQALMYPLLVATKSQSPARRQAAYS
VLECIRQHSAALVEQAQLGLELAVPGTYIAGEPLVTIAAFAPQLHVISSKQRPRKLTIHG
GDGAEYMFLLKGHEDLRQDERVMQLFGLVNTMLAHDRITAERDLSIARYAVIPLSPNSGL
IGWVPNCDTLHALIREYRCKVEVFEYALDSTSGEDLHKSRNSEVWLDRRTNYTRSAAVMS
MVGYILGLGDRHPSNLMLDRYSGKLLHIDFGDCFEASMNREKFPEKVPFRLTRMMIKAME
VSGIEGNFRTTCENVMRVLRSNKESVTAMLEAFTREKELKEAFVNLGDANEVGRLINMAV
NHENLCQSYIGWCPFW
NT seq 5091 nt NT seq  +upstreamnt  +downstreamnt
atgatgctgtcgggagtgggtccggtgcccaccaaaccggctttcaaggccggtggcgac
acgctctcgcggcacctggaggagctgtgccgttctggcgcatgggagcggcgccacaag
gatggtgacaaagcattattggagtacatcgaggcggaggctcgggacctgtcggtggag
gcttttgggcggctaatgaccgacgtgtatcagcgcatcggcaacatgctgctcaaaggg
aacgacatcacgcggcgcatgggtggcgtgctggcgattgacgagcttatcgatgtcaag
ctctctggagacgacgctgccaagacggcgcggctgtcggggctgctgtcgcgggtgctg
gaggagagcgaggacccggtgctcagcgagtcggcctcgcacacgctgggacacctggtg
cgcagcggcggcgccatgacgtcggacatcgtggagaaggagatccgccgctcgcttgcc
tggtgcgacccccgcaatgagcccaatgagtcgcggcggctgactgcgctgctggtgctg
acggaggcggcggagtccgcgcccgccgtgttcaacgtgcacgtcaagtcgttcattgac
gcggtgtggttcccgctgcgcgacgccaagcagcatatccgcgaggcggcggtgcgggcg
ctcaaggcttgcctgtgcctggtggagaagcgcgagacgcgctaccgcgtgcagtggtac
tacaagctgcacgagcagaccatgcgcggcatgaagcgcgaccaccgcaccggcgcgctt
ccctcgcccgagtccatccacggctcgctgctggcgctggcggagctgctacagcacacc
ggcgaattcatgctggcgcgctacaaggaggttgtggagaacgtgttccgctacaaggac
agcaaggagaaaaacatccgccgggcggtcatccacctgctgccgcgcatggcggccttc
tcgccggagcgctttgcgtcggagtacctggctcgcgccattgccttcctgctgatcgtg
ctgaagaacccgcccgagcgcggcgcggcgttcgcggcgctggcggacatggcggcggcc
ctggcgcgggtcaactgcgcggcgggcgtgagcgaggtgctggtgcaggcgctgacgcag
gtcgccaacgcgctgccggagcttctggaggacatccagtaccagctgctggacctgctg
agcctggtgctcagcaagaggcccttcaacagcagcaccacgcagcccaagttcgcggcc
ctgagtgcggccatcgcggcgggcgagctgcagggcaatgcactcaccaagctggcgctg
cagacactgggcacgtttgacctgggcggcatccagcttctggagttcatgcgcgaccac
atcctggcctacaccgacgaccccgacaaggagatccgccaggccgcggccgactgcctg
cgcgcgctgttcgtgggcatgaacgacgagagcgtggcggtgcgcgggctggccatccgg
ctggtggggcggctggcggagcgcaacccggcgcacgtgaacccggcgctgcgcaagcac
ctgctgcagctgctgcacgacatggagttcagccccgacaacagggccagggaggagtcg
gccttcctgctggaggtgctcatcaccgccgccgcccgcctcatcatgccctacgtctcg
cccatccagaaggcgctggccaaagcggcggcgctacagcgagacctggtcaacgagaac
aacgtcatcaagactgtgttgtccacgctgggcgcgctggctgaggtgagcggcaccacg
ttccgccccttcatcagcgaggtcatgccgctggtcatcgaggccattcaggacaactcg
gacgggcggcggcgtgtggtggccgtcaagactctgggcttcatcgtgagcagctgcggc
aatgtgatgggcccctacctggagtacccacagctgctgtcggtgctgctgcgcatgctg
cacgagggacaccccgcgcaacgccgggaggtcatcaaggtgctgggcatcatcggcccc
ggcgacgacggcggccccggcggcgacctgctgccctcctcgggcctggtgaccagcagc
gaggactattaccccaccgtggccatcaacgcgctgatgcgggtgctgcgcgaccccgcc
ctggcctcccagcacctggccgtcatccgggcgctggcagccatattccgcgcgctgcag
ctcagcgtagtcctgcccatcctgctgggcgtgctgcgcggcggcgacgaggcgctgcgt
gaggagatcctggcctcgctgcgcgcgctggtgggctacgtgcggcagcacatgcgccgc
ttcctgcccgacctcacgcagctggtgcacgagttctggcccgccgcgccgcgcacctgc
ctggcgctcatagcggacctgggcatggcgctgagggacgacatacggtgcgtcctggac
ggccacagcgacgagcagctgcggcgtgatgcgctagacaccatctgcgccgtggccgtg
tgcctggggcccgagttcgccatcttcgtgcccaccatccgcaaggcctgccagcggcac
cgcctgcaccacgagtggttcgaccggctggccggcaagagcagccaccgcgtgaccaag
gaggactgggcggagtggatgcgcaacttcgcggtggagctgctcaaggagagcccctcg
cccgcgctgcgcgcctgccacggcctggcgcaggtgcaccccagcatggcgcgcgagctg
ttcgcggcgggcttcgtgagctgctgggcggagctggagcaggggctgcaggagcagctc
gtgcgcagcctggaggctgcgctggcctcccccaccatcccccccgagacggtgactgcg
ctgctgaacctggccgagttcatggagcacgacgacaagcgcctgcctctggacacacgc
acgctgggggcgctggcggagaagtgccacgccttcgccaaggcgctgcactacaaggag
ctggagttccagaccagcccgcagtccgccatcgaggcgctcatccacatcaacaaccag
ctgcggcagccggaggcggcggtgggcgtgctggcgtacgcccagaagcacctgcacatg
gagctcaaggagggctggtatgagaagctgtgccgctgggacgaggcactggacgcctac
gagcggaggctgctcaaggaggcgccgggcagcatggagtaccacacactgctgcgctac
aaccctatgaacatcactcaggccggcaaccccggctacggcgccggcagcggcgcgccg
cacgtgatgctggccttcctgaagcacctgtggacgcagggcaaccgcacagaggcctac
aaccgcatcaaggacctggaggccagccgcctgtacttcggcgagagcaatgtggagggc
atgctgaacacgctgctgccgctgcacgagatgctggagaaggcggggcccaccacactc
aaggaaatcgccttcgtgcagagctacggccgggagctgtcggaggcgtacgagtggctg
atgaagtacaaggccagccgcaaggaggcggagctgcaccaggcctgggacctgtactac
cacgtcttcaagcgcatcaacaagcagctgcactccctaaccacgctggagctgcagtac
gtcagccccgcgctggtgcgggcgcagaagctggacaacccgggtgtgattgcggagaac
ctggcttccttccgcgcggccaccgagcacgcgcccaattgggccaaggcctggcaccag
tgggcgctgttcaatgtggcggtttcagcgcactacagcgtggcgctggggcaggcggcg
ggcgaccgcacaggcaacctgcaggacatcctgcggctgctgacgctgtggttcaacttc
ggcgcgtacgccgaggtccgcgccgcgctgacggagggcttccagctggtgtccatcgac
acctggctgctggtcatcccgcagatcatcgcgcgcatccacacccacaacacagacgtg
cgccagctcatccaccacctgctggtcaagatcgggcgccaccacccgcaggctctgatg
tacccgctgctggtggccaccaagtcccagagcccggcccggcgccaggcggcctacagc
gtgctggagtgcatccggcagcacagcgcggcgctggtggagcaggcgcagctgggcctg
gagctggcagtgcccggcacctacattgccggggagccgctggtgaccatcgccgccttc
gcgccgcagctgcacgtcatcagctccaagcagcgcccgcgcaagctcaccatacacggc
ggcgacggcgcggagtacatgttcctgctcaagggccacgaggacctgcgccaggacgag
cgcgtgatgcagctgtttggcctggtgaacaccatgttggcgcacgaccgcatcaccgcc
gagcgcgacctgtccatcgcgcgctacgccgtcatcccgctgtcgcccaacagcggcctc
atcggctgggtgcccaactgcgacacgctgcacgcgctcatccgggagtacaggtgcaag
gtggaggtgttcgagtacgcgctggactccaccagcggcgaggacctgcacaagagccgc
aacagcgaggtttggctggaccggcgcaccaactacacccgctccgccgccgtcatgtcc
atggtgggctacatcctgggcctgggcgaccgccacccctccaacctcatgctggaccgc
tacagcggcaagctgctgcacatcgactttggcgactgcttcgaggcgtccatgaaccgg
gagaagttcccggagaaggtgccgttccggctcacgcgcatgatgatcaaggccatggag
gtgtcgggcatcgagggcaacttccgcaccacgtgcgagaacgtgatgcgcgtgctgcgc
tccaacaaggagagcgtgaccgccatgctggaggccttcacgcgggagaaggagctcaag
gaggcgtttgtgaacctgggcgatgccaacgaggtggggcgcctcatcaacatggcggtc
aaccacgagaacctgtgccagagctacatcggctggtgccccttctggtag

DBGET integrated database retrieval system