KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_176554Help
Entry
CHLREDRAFT_176554 CDS       T01039                                 

Gene name
PYR7
Definition
CTP synthase (EC:6.3.4.2)
Orthology
K01937  
CTP synthase [EC:6.3.4.2]
Organism
cre  Chlamydomonas reinhardtii
Pathway
Pyrimidine metabolism
Metabolic pathways
Module
Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:cre00240]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 306 aa AA seqDB search
MQQTKYVLVTGGVVSGLGKGVTASSVGVLLKNCGYRVTSIKIDPYINVDAGTMSPFEHGE
VFVLDDGGEADLDLGNYERFLDITLTRDNNITTGKIYQAVIERERRGDYLGKTVQVVPHI
TDAIQDWIQRVAARPVDGNSGVPHVCVIELGGTEPLEESVRTKLALFCNVPEGCVLSLHD
VSNIWRVPLLMQEQNVHHLLCTKLGLTAADKLDLSVWKANLADRWDSLTEPIAVIEFARN
VLGLKEANSTEFAPACPHPAVVFMPEISTTHLGGTMRLVQSRPGKPSPLFLGFILASAKR
LDSYLR
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgcagcagactaaatacgtgcttgtgacgggaggtgtggtcagcggcctcggcaagggt
gttaccgctagcagcgttggtgtgctgctcaagaactgcggctatcgcgtgacgtccatt
aaaattgatccctacatcaatgtggacgctggcactatgtcgccattcgagcacggcgag
gtctttgtgctggacgatggcggcgaggccgaccttgacctcggcaactacgagcgcttc
ctggacatcaccctgacccgcgacaacaacattacaaccggcaaaatttaccaggctgtg
attgagcgcgagcgccgcggcgactacctgggcaagaccgtgcaggtggtgccgcacatt
acggacgcgatccaggattggatccagcgtgtggcggcgcgccccgtggatggcaactcg
ggcgtgccgcacgtgtgcgttattgagctgggaggcacggagccgctggaggagagcgtg
cggacaaagctggctctgttctgcaacgtgcccgagggctgtgtgctgtcgctgcacgac
gtgtccaacatctggcgcgtgccgctgctgatgcaggagcagaatgtgcaccatctgctg
tgcaccaagctgggtctgacggcggctgacaagctggacctgtcggtgtggaaggccaac
ctggcggaccgctgggactcgctcacggagccgattgcggtgattgagtttgcgcgcaac
gtgcttggcctcaaggaggccaactccaccgagttcgcgcccgcctgcccgcaccccgcc
gtggtgttcatgcccgagatctccaccacacacctgggcggcactatgcgcctggttcag
tcgcggcccggcaagccctcgccgctgttcctgggcttcatcctggcctccgccaagagg
ctggactcctacctgcggtga

DBGET integrated database retrieval system