KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_176554Help
Entry
CHLREDRAFT_176554 CDS       T01039                                 

Gene name
PYR7
Definition
CTP synthase (EC:6.3.4.2)
Orthology
K01937  
CTP synthase [EC:6.3.4.2]
Organism
cre  Chlamydomonas reinhardtii
Pathway
Pyrimidine metabolism
Metabolic pathways
Module
Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:cre00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    CHLREDRAFT_176554 (PYR7)
Enzymes [BR:cre01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.2  CTP synthase (glutamine hydrolysing)
     CHLREDRAFT_176554 (PYR7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 306 aa AA seqDB search
MQQTKYVLVTGGVVSGLGKGVTASSVGVLLKNCGYRVTSIKIDPYINVDAGTMSPFEHGE
VFVLDDGGEADLDLGNYERFLDITLTRDNNITTGKIYQAVIERERRGDYLGKTVQVVPHI
TDAIQDWIQRVAARPVDGNSGVPHVCVIELGGTEPLEESVRTKLALFCNVPEGCVLSLHD
VSNIWRVPLLMQEQNVHHLLCTKLGLTAADKLDLSVWKANLADRWDSLTEPIAVIEFARN
VLGLKEANSTEFAPACPHPAVVFMPEISTTHLGGTMRLVQSRPGKPSPLFLGFILASAKR
LDSYLR
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgcagcagactaaatacgtgcttgtgacgggaggtgtggtcagcggcctcggcaagggt
gttaccgctagcagcgttggtgtgctgctcaagaactgcggctatcgcgtgacgtccatt
aaaattgatccctacatcaatgtggacgctggcactatgtcgccattcgagcacggcgag
gtctttgtgctggacgatggcggcgaggccgaccttgacctcggcaactacgagcgcttc
ctggacatcaccctgacccgcgacaacaacattacaaccggcaaaatttaccaggctgtg
attgagcgcgagcgccgcggcgactacctgggcaagaccgtgcaggtggtgccgcacatt
acggacgcgatccaggattggatccagcgtgtggcggcgcgccccgtggatggcaactcg
ggcgtgccgcacgtgtgcgttattgagctgggaggcacggagccgctggaggagagcgtg
cggacaaagctggctctgttctgcaacgtgcccgagggctgtgtgctgtcgctgcacgac
gtgtccaacatctggcgcgtgccgctgctgatgcaggagcagaatgtgcaccatctgctg
tgcaccaagctgggtctgacggcggctgacaagctggacctgtcggtgtggaaggccaac
ctggcggaccgctgggactcgctcacggagccgattgcggtgattgagtttgcgcgcaac
gtgcttggcctcaaggaggccaactccaccgagttcgcgcccgcctgcccgcaccccgcc
gtggtgttcatgcccgagatctccaccacacacctgggcggcactatgcgcctggttcag
tcgcggcccggcaagccctcgccgctgttcctgggcttcatcctggcctccgccaagagg
ctggactcctacctgcggtga

DBGET integrated database retrieval system