KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_176554Help
Entry
CHLREDRAFT_176554 CDS       T01039                                 

Gene name
PYR7
Definition
(RefSeq) CTP synthase
  KO
K01937  CTP synthase [EC:6.3.4.2]
Organism
cre  Chlamydomonas reinhardtii
Pathway
cre00240  Pyrimidine metabolism
cre01100  Metabolic pathways
Module
cre_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:cre00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    CHLREDRAFT_176554 (PYR7)
Enzymes [BR:cre01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.2  CTP synthase (glutamine hydrolysing)
     CHLREDRAFT_176554 (PYR7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTP_synth_N CbiA ArgK
Motif
Other DBs
NCBI-GeneID: 5723215
NCBI-ProteinID: XP_001697609
JGI: 176554
UniProt: A8J825
Position
Unknown
AA seq 306 aa AA seqDB search
MQQTKYVLVTGGVVSGLGKGVTASSVGVLLKNCGYRVTSIKIDPYINVDAGTMSPFEHGE
VFVLDDGGEADLDLGNYERFLDITLTRDNNITTGKIYQAVIERERRGDYLGKTVQVVPHI
TDAIQDWIQRVAARPVDGNSGVPHVCVIELGGTEPLEESVRTKLALFCNVPEGCVLSLHD
VSNIWRVPLLMQEQNVHHLLCTKLGLTAADKLDLSVWKANLADRWDSLTEPIAVIEFARN
VLGLKEANSTEFAPACPHPAVVFMPEISTTHLGGTMRLVQSRPGKPSPLFLGFILASAKR
LDSYLR
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgcagcagactaaatacgtgcttgtgacgggaggtgtggtcagcggcctcggcaagggt
gttaccgctagcagcgttggtgtgctgctcaagaactgcggctatcgcgtgacgtccatt
aaaattgatccctacatcaatgtggacgctggcactatgtcgccattcgagcacggcgag
gtctttgtgctggacgatggcggcgaggccgaccttgacctcggcaactacgagcgcttc
ctggacatcaccctgacccgcgacaacaacattacaaccggcaaaatttaccaggctgtg
attgagcgcgagcgccgcggcgactacctgggcaagaccgtgcaggtggtgccgcacatt
acggacgcgatccaggattggatccagcgtgtggcggcgcgccccgtggatggcaactcg
ggcgtgccgcacgtgtgcgttattgagctgggaggcacggagccgctggaggagagcgtg
cggacaaagctggctctgttctgcaacgtgcccgagggctgtgtgctgtcgctgcacgac
gtgtccaacatctggcgcgtgccgctgctgatgcaggagcagaatgtgcaccatctgctg
tgcaccaagctgggtctgacggcggctgacaagctggacctgtcggtgtggaaggccaac
ctggcggaccgctgggactcgctcacggagccgattgcggtgattgagtttgcgcgcaac
gtgcttggcctcaaggaggccaactccaccgagttcgcgcccgcctgcccgcaccccgcc
gtggtgttcatgcccgagatctccaccacacacctgggcggcactatgcgcctggttcag
tcgcggcccggcaagccctcgccgctgttcctgggcttcatcctggcctccgccaagagg
ctggactcctacctgcggtga

DBGET integrated database retrieval system