KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_181887Help
Entry
CHLREDRAFT_181887 CDS       T01039                                 

Gene name
PRO1
Definition
profilin
Orthology
K05759  
profilin
Organism
cre  Chlamydomonas reinhardtii
Brite
Exosome [BR:cre04147]
 Exosomal proteins
  Proteins found in most exosomes
   CHLREDRAFT_181887 (PRO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 131 aa AA seqDB search
MAWEAYITSNLMCPVDSEGNTLDSAAILGLDGSSVWASSAAFQALNDEEARKFVAAFDDV
SIASVMLAGAKYLKTSADGTIFRGRKDKSGFVARKGAQCIIIGFYTDPPVSAQTCNKVVE
ALADYLADQGY
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atggcctgggaagcctacattacctccaacctgatgtgcccggtggactcagagggaaac
actctggacagcgcagcgattctgggcctggatggcagctcagtctgggcgagcagcgcc
gcgtttcaggcgctgaacgatgaggaggccaggaagtttgttgctgcattcgatgacgtc
tccattgcttcggtgatgcttgcgggtgccaagtacctgaagacttctgcagacgggacc
attttccgcggccgcaaggacaagagcggctttgttgctcgcaagggcgcccagtgcatc
attattggcttctacacggatccgccggtctccgcccagacctgcaacaaggtggtggag
gctctggctgactacctcgcggaccaggggtactaa

DBGET integrated database retrieval system