KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_181974Help
Entry
CHLREDRAFT_181974 CDS       T01039                                 

Gene name
CGK2
Definition
cGMP-dependent protein kinase
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
cre  Chlamydomonas reinhardtii
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1027 aa AA seqDB search
MGCAQSTPVDQPARQQPQATQQKSVEPAVVKKPVEPARVEPKVEVPSTKPSEVPHVEKAQ
SINRGQPGDGSGPLQQPSPAMPGAKQGGTKERRAAAGSEAVRDQIRKLAVGGPQAKEEKE
KIYEVSDSEDEELEDDPSERTTLSGDWYKPQEVTDAILEALKRNFVFKGIPQNHLVEVVG
RMYGISFKSGAVVLQQGALPKQDDCMYYLQQGEAEVVISGGADASKNHGEERKVDGHTVR
IPQKPGWLFGDVALLFHSPRTASVVAKTNITVWAMDRRTFLKFVMKHAQGARALRFLRKL
PLLKGLSDNDLIRAASRMPQRMYEDGQPLIRIGERGDELFLIRYGKVRVFRPDGNGGRVE
VAVLGRGQFVGERAVINDKLRSADCVAQGQVQVVVLKKREFMDLDNPLLAWMLDYDAVSA
VIRSLPQFKGLKQEQMENILDRFDAREELMQGDTILNQGDMLEKLYVVKIGEIALFRNDE
RVEDPNFVHEIAGFSYFGETAITQTGKCPYTIRVASESLHLLSLPKRQVDSFMGRDTGLK
NEEAVVAALKKSKFLANMTDPEFKELLKACEQTDYNPGEVIAVANSSVTNKIFLVKSGEV
MVVAADLALPDTGEVDVRKLTGSERQRLLAGSIFNDKALNSPETASLEASLVAGTPCGII
TFTTSDVERVMGGRAMSRSRNAMPGAAAAVEERKFPRVKFTELEFHRIIGTGQFGLVRVV
RNIKTNEVYALKVMHKAPIVESKQIEHVINERKILEEACTHPFCVRLCGAYQDKASLYLL
QEWVPGGELFHHLDVEGAFDEPTAMFYAANVLLALEFLHAKGIVYRDLKPENLLLDTQGY
IKMADFGFAKYIGGDKTYTICGTPDYQAPEVIMRRGTTKAADYWALGVLIFEMLVGDPPF
KSLTGDPWDTFRRTLSGRFYVPNFISDQAADLIFKLLQVNPDKRLGSDKRLGAEEIKRHR
WFSRIDWRALEQKKLPSPFRPRVRNPLDTSNFDNFDNVDLEPPPVPADRAEKHSQQWELW
DWIDDSK
NT seq 3084 nt NT seq  +upstreamnt  +downstreamnt
atggggtgtgcacagagtactccggttgaccagccggcgcggcagcagccgcaagcaacg
cagcagaagtctgtggagcctgcggtggtgaagaagccagtcgagccagcaagggtcgag
ccgaaggtggaggtgcccagcactaagccctcggaggtaccgcacgtagagaaggcacag
agcattaatcgagggcagcctggcgatggctcagggccgctgcagcagccgtcgcccgca
atgcccggagcaaagcagggcggaacaaaggagcgtcgtgcggcggcgggttcggaggct
gtaagagatcaaattaggaagcttgcggtcggtgggccgcaagccaaggaggagaaggag
aagatttacgaggtcagcgactcagaggatgaggagctggaggacgacccaagcgagagg
accacactctctggcgactggtacaaaccccaggaggtgacggacgccattctggaggcc
ctcaaacgcaactttgtgtttaaaggcattccgcagaatcacctggtggaggtggtgggc
cgcatgtacggcatcagcttcaagtcgggcgcggtggtgctgcagcagggcgcgctgccc
aaacaggacgactgcatgtactacctgcagcagggcgaggcggaggtggtgattagtggt
ggagcagatgcctctaagaaccacggagaggagcgcaaggtggacggccacaccgtgcgc
atcccgcagaagcccgggtggctgttcggtgatgtggcgctgctgttccactcgccgcgt
accgcctcggtggtggcgaaaaccaacatcacagtctgggccatggaccggagaacgttt
ttgaagttcgtgatgaagcatgcgcagggtgcgcgcgcgctgcgcttcctgcgcaagctg
ccgctgctgaagggtctgtcggataacgacctgatccgcgcggcgtcgcgcatgccccag
cgcatgtacgaggacgggcaaccgctgatccgcatcggcgagcgcggtgatgagctcttc
ctgattcgctacggcaaggtgcgcgtcttccgccccgacggcaacggcgggcgcgtggag
gtggcagtgctgggccgcggccagttcgtgggtgagcgcgccgtcatcaacgacaagctg
cgcagcgccgattgcgtggctcagggccaggtgcaggtggtggtgctgaagaagcgcgag
ttcatggacctggacaacccgctgctggcgtggatgctcgactacgacgccgtgtcggcg
gtcatccggtcgctgccgcagttcaaggggttgaagcaggagcagatggagaacatcctg
gaccgcttcgacgcgcgcgaggagctgatgcagggcgacaccattctcaaccagggcgac
atgctggagaagctgtacgtggtgaagatcggcgagattgcgctgttccgcaacgacgag
cgcgtggaagaccccaactttgtgcacgaaatcgccggcttcagctactttggcgagacg
gccatcacgcagacgggcaagtgcccatacaccatccgcgtggcgtcggagtcgctgcac
ctgctgtcgctgcccaagcggcaagtggactcgttcatgggccgcgacacggggcttaag
aacgaggaggcggtggtggcggcgctgaagaagtccaagttcctggccaacatgaccgac
cccgagttcaaggagctgctcaaggcgtgcgagcagaccgactacaaccccggcgaggtg
attgcggtcgccaacagctcggtgaccaacaagatcttcctggtgaagagcggcgaggtc
atggtggtggcagcagacctagcgctgccggacaccggcgaggtggacgtgcgcaagttg
acgggcagcgagcggcaacggctgctggcgggcagcatattcaacgacaaggcgctcaac
agcccagagacggcgtcgctggaggcatccctggtggcgggcacgccctgcggcatcatc
accttcaccacgtcggatgtggagagggtgatgggcggccgcgccatgagccgcagccgc
aacgcgatgccgggcgccgccgctgcggtggaggagcgcaagttcccgcgcgtcaagttc
acggagctggagttccaccgcatcatcggcacggggcagttcggcctggtgcgcgtggtg
cgcaacatcaagacaaacgaggtgtacgcgctcaaggtgatgcacaaggcgcccatcgtg
gagtccaagcagatcgagcacgtgatcaacgagcgcaagattctggaggaggcctgcacg
caccccttctgcgtgcgcctgtgcggcgcgtaccaggacaaggcgagcctgtacctgctg
caggagtgggtgccgggcggcgagctgttccaccacctggacgtggagggtgcgttcgac
gagcccaccgccatgttctacgccgccaacgtgctgctggcgctggagttcctgcacgcc
aagggcatcgtgtaccgcgacctgaagcccgagaacctgctgctggacacccagggctac
atcaagatggctgactttggcttcgccaagtacattggtggtgacaagacctataccatc
tgcggtacgcccgactatcaggctcccgaggtgatcatgcgccgtggcaccaccaaggcc
gccgactactgggcgctgggcgttctcatcttcgagatgctcgttggcgacccgcccttc
aagtcgctcaccggcgacccctgggacaccttccgccgcaccctgtccggccgtttctac
gtgccaaacttcatttcggaccaggccgccgacctcatcttcaagctgctgcaggtcaac
cccgacaagcgcctcggcagcgacaagcgccttggcgcggaggagatcaagcggcaccgc
tggttcagccgcatcgactggagggcgctggagcagaagaagctgccgtcgccgttccgg
cctcgcgtgcgcaacccactggacacttccaacttcgacaacttcgacaatgtggacctg
gagccgccacccgtgcccgccgaccgcgcggagaagcacagccagcaatgggagttgtgg
gactggatcgacgacagcaagtaa

DBGET integrated database retrieval system