KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_182375Help
Entry
CHLREDRAFT_182375 CDS       T01039                                 

Definition
ubiquitin carboxyl-terminal hydrolase
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
cre  Chlamydomonas reinhardtii
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 331 aa AA seqDB search
MEWTTIESDPGVFTELIENIGVKGVQVEELWSLDQLRELSPVFGLVFLFKWKKEPVRPAT
TTDAGQVFFAKQVISNACATQAILNILLNVKAPGLDLGTELANLREFVSDFDPTMKGLAI
SNSDLIRTAHNSFARPEPLVPDNDKDDEKSGDAYHFISYVPVGGKLFELDGLQEGPIELC
DCTDDDWLDKVGPHITARMERYAASEIRFNLMALVGNRVDIFSSRLAAATAQRDQLAAAA
AAADGMSDEDLAHAQAKLLEAETEVANLQEALAAEQAKHRTWHEENVRRKHNYVPCLFQL
LKLMAARGQMGPLLERARRPAAAGGGNGTKQ
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggagtggacgacaatagaatcggacccaggcgtctttacggagctcatagagaacatt
ggcgtcaaaggcgttcaagtagaggagctatggtcacttgaccagcttagagagctcagt
cctgtctttggcctggtattcctattcaagtggaaaaaggagccggtccggccggccaca
acgacagacgcggggcaggtgttctttgccaagcaggtcatcagcaacgcgtgcgcaacc
caggctatcctgaacatcttgctcaatgtgaaagctccaggattggacttgggcacggag
ctggcgaacttgcgtgagttcgtctcagacttcgaccccaccatgaagggcctggccatc
agcaacagtgacctcatccggactgcacacaactcgttcgcgcgtcccgagccgctggtg
cctgacaatgacaaggacgacgagaagagtggcgacgcctaccacttcattagctacgtg
ccggtgggcggcaaactgtttgagctggacggcctgcaggagggccccatcgagctgtgc
gactgcaccgacgacgactggctggacaaggtcggaccgcacatcaccgcccgcatggag
cggtacgcggccagcgagatcaggttcaacctgatggcgctagtgggcaaccgggtcgac
atcttcagcagccgcctggcggccgccacggcacaacgggaccagctggcggcggcagca
gcagcagcggacggcatgagcgatgaagacctcgcccacgcccaggccaagttgctggag
gcggagaccgaggtggccaacctgcaggaggcgctcgcagcagagcaagccaagcaccgc
acgtggcacgaggagaacgtacgccgcaagcacaattacgttccatgtctgttccagctc
ttaaagctgatggctgcgcgaggccagatgggaccgctgctggagcgggcgcgccggcct
gcagcggccggcggaggcaatggtacgaagcagtga

DBGET integrated database retrieval system