KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_183011Help
Entry
CHLREDRAFT_183011 CDS       T01039                                 

Gene name
UOX
Definition
urate oxidase II
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
cre  Chlamydomonas reinhardtii
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cre00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CHLREDRAFT_183011 (UOX)
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    CHLREDRAFT_183011 (UOX)
Enzymes [BR:cre01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     CHLREDRAFT_183011 (UOX)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 208 aa AA seqDB search
MATYALPLHHHGKSKVRLGRVWRDGNVHHMVEWNVNTMIDSDMEHAFLNGDNTGMTATDT
QKNTVYVVAQRMSQKCTIEQYAIALAQHFVRTYPLVSKAKIYVEQKPWTRVQQSGLPHDH
GFALQGTEVRTVYVTYDKAGTLDVTAGNILDRVPTSESIFLNMPNLHFIPCNPVGSSFNN
DVYVATSEPHGNIEAVITRKGIAPHCKL
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggccacctacgccctgccgctgcaccaccatggcaagagcaaggtccgcctggggcgc
gtctggcgcgacggcaacgttcaccatatggtggagtggaacgtgaacactatgattgac
tctgatatggagcacgcgttcctgaacggtgacaacacgggcatgaccgccacggacacc
cagaagaacacggtctacgtggtggcgcagcggatgtcccagaagtgcacaatcgaacaa
tatgcgatcgcgttggctcagcactttgtgcgcacctacccgctggttagcaaggccaag
atctatgtggagcagaagccatggactcgcgtccagcaatcgggcctgcctcacgaccac
ggctttgcgctgcagggcaccgaggtgcgcactgtgtacgtgacctacgacaaggccggc
accctggacgtgacggcggggaacatcctcgaccgtgtgcctacgtcggagagcatcttc
ctcaacatgcccaacctgcacttcattccctgcaaccccgtgggatcctccttcaacaac
gacgtgtacgtggccacctcggagccgcacggcaacatcgaggccgtcatcacgcgcaag
ggcatcgcgccgcactgcaagctgtaa

DBGET integrated database retrieval system