KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_183031Help
Entry
CHLREDRAFT_183031 CDS       T01039                                 

Gene name
MAPK6
Definition
mitogen-activated protein kinase 6 (EC:2.7.1.-)
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
cre  Chlamydomonas reinhardtii
Brite
Enzymes [BR:cre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     CHLREDRAFT_183031 (MAPK6)
Protein kinases [BR:cre01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   CHLREDRAFT_183031 (MAPK6)
Exosome [BR:cre04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CHLREDRAFT_183031 (MAPK6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 375 aa AA seqDB search
MAQAPQAGSSSGSSNIPVKQDCPIPGKARYVLWRSTFEIDDKYVPIKAIGKGAFGVVCSA
KDTKTGEKVAIKKIGNAFENLIDARRTLREIKLLRHLRHENIIQVKDVLKPPSRDNFNDV
YIIYELMDTDLHQIIRSSQTLTNEHFQYFVYQVLRGLKYVHTANVLHRDLKPSNLLLNAS
CDLKIADFGLARTGTEKQNFMTEYVVTRWYRAPELLLSCDTYTTAIDVWSVGCILAELLG
RKPLLPGKDYVDQLKLIIKTLGPPSEEDLGFITSSKARAYIRALPPSEKINFRKLFPDAD
PLAIDLMEKMLQFDPRKRIDVIQALKHPWLAQLHEEAAEPAAAGEFVLDFDEMTLNETGV
RQMIYDEAVNHYGHK
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggctcaagcaccacaggcaggctcttcttcagggtcgtcgaacatccccgttaagcaa
gactgtcccataccaggcaaagcgcgctatgtgctctggaggtccacattcgagattgac
gataaatacgtgccaatcaaggcgatcggcaaaggagcctttggtgtggtgtgcagcgcg
aaggacactaagacgggggagaaggttgctatcaagaaaatcggcaacgcgttcgagaac
ctgattgacgcacggaggacgttgcgtgagatcaagctgctgcgacacctgcgccatgag
aacatcatccaggtcaaggacgtgctcaagccgccgtcccgcgacaacttcaacgacgtt
tacattatctacgagctgatggacacagacctgcaccaaatcatccgctcctcgcagacg
ctcacaaacgagcacttccagtacttcgtctaccaggtgctccgcgggctcaagtacgtg
cacacggccaacgtgctgcaccgcgacctcaaacccagcaacctgctgctgaacgcgtcg
tgcgacctgaagattgcggacttcggcctggcgcggacaggcaccgagaagcagaacttc
atgactgagtacgtggtgacgcgctggtaccgcgcgccggagctgttgttgtcctgcgac
acgtacaccacggcgatcgacgtctggtccgtgggctgcattctggctgagctgctgggc
cgcaagccgctgctgccgggtaaggattacgtggaccagctcaagctcatcatcaagacg
ctggggccccccagcgaggaggacctgggcttcatcaccagttccaaggcgcgcgcctac
atccgcgcgctgccgccctcggagaaaatcaactttcgcaagttgttccccgatgcggac
ccgctcgccatcgacctcatggagaagatgctgcagttcgacccccgcaagcgcattgac
gtcatccaggcgctgaagcacccttggctggcgcagctacatgaggaggcggcggagccc
gcggcggcaggcgagtttgtgctggactttgacgagatgacgctcaacgaaacgggcgtg
cggcaaatgatctatgacgaggccgtcaaccactacggccacaagtga

DBGET integrated database retrieval system