KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_183141Help
Entry
CHLREDRAFT_183141 CDS       T01039                                 

Gene name
AMYB1
Definition
beta-amylase (EC:3.2.1.2)
Orthology
K01177  
beta-amylase [EC:3.2.1.2]
Organism
cre  Chlamydomonas reinhardtii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cre00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 594 aa AA seqDB search
MPTSLPQCPSAPRSVQPLRSALLAAQRLSQCRGSRSQRGSGACHSQGRQVTHPTAHPRTS
RTLDDDSGFASFAPEPIVTTPGASAFSEVEDDLQIHRLLRETGQHIKIPMIDEDRFDTQY
PESQAEEPSSSGSGCPVYVMLPLDTVWVVERDGKRISVLKKERSLDIALHTLKQAGVEGV
MVDVWWGIVERAGPRQYDFSAYKRLFYKVAAAGLKVQAVMSFHAAGGNVGDTCKIPLPKW
VLEIGERNPDIFYTDKAGHRNRECLSLGCDEVPLFWGRTPVLMYRDFINAFADKFQHLFG
TVITEVTVGLGPAGELRYPSYPEGDGRWRFPGVGEFQCYDKFMLESLRRTAEAAGHAEWG
LSGPHDAGHYNSSSWETGFFVSQNGSWNTAYGHFFLSWYSNMLLEHADRVLSSAAEVLNK
HGRPRVFNSMRDASNGHVIYEFTPACKMGIKLAGVHWWFKSRAHAAELTAGYYNTRDRDG
YLPFMAMLRRHDASLSFTCVEMRDCEHPPEGRCSPQALLQQVIEAAEKYGVPLSGENALQ
RYDDYAFERIAESAFGRNARAGRLTQVTFLRMGDLMFDNWDAFSRFLNRMRNKA
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atgccgacctcgctgccccagtgccccagtgctcctcgcagcgtccagcctctgcgcagc
gcgcttcttgcagcacagcgactgtcgcaatgcagaggctcgcgaagccagcgagggagc
ggggcctgccactcgcaagggcgccaagtgacgcaccccactgcgcacccgcgcacttcg
cggacgctagacgacgactcaggcttcgctagcttcgcgccggagcccatagtcacaacg
ccaggagccagtgcgttctcagaagtggaggacgacttgcaaatccacaggctcttgcga
gaaaccgggcaacatataaagattccaatgatagacgaggaccgcttcgacacgcagtat
ccggagagccaggcggaggagccttcctcaagcgggtccgggtgcccggtctatgtcatg
ctgccgctcgacactgtctgggtggtggagcgcgacggcaagcggatatccgtgcttaaa
aaggagcgctcgctcgacatcgcgctgcacacgttgaagcaggctggcgtggaaggtgtc
atggtggacgtctggtggggtatcgttgagcgcgccgggcctcgccagtatgacttctcc
gcctacaagcggctattttacaaggtcgctgcagcgggtctgaaggtgcaggcggtgatg
agcttccacgcagcgggcggaaatgtcggggatacgtgcaaaatcccgctgccaaagtgg
gttctcgaaatcggcgagcgcaacccggacattttctacacggacaaggcggggcaccgg
aaccgggagtgcctgtcgctcggctgcgatgaggtgccgctgttttggggccgcacgccg
gtgcttatgtaccgcgatttcatcaacgccttcgcggacaagttccagcacctgttcggg
acggtcatcacggaggtcactgtggggctcgggccggcgggcgagctgcggtacccttcc
tacccggagggcgacggccggtggcggttcccgggcgtgggcgagttccagtgctacgac
aagttcatgctcgaaagcctgcggcgaacagcggaggcggcggggcacgcggagtggggt
ctgagcgggccgcacgatgcggggcactacaacagcagcagctgggagacggggttcttc
gtcagccagaacggcagctggaacacggcgtacggacacttcttcctgtcgtggtacagc
aacatgctgctggagcacgcggaccgtgtgctgtcgtcagcggcggaggtgctgaacaag
cacgggcggccgcgcgtgttcaactcgatgcgtgacgcgtccaacgggcacgtcatctac
gagttcacgccggcgtgcaagatgggcatcaagctggcgggcgtgcactggtggttcaaa
tcgcgcgcgcacgcggcggagctgacggcgggctactacaacacgcgggaccgggacggc
tacctgcccttcatggccatgctgcggcggcacgacgcatcgctcagcttcacgtgcgtg
gagatgcgcgattgcgagcacccgccggaggggcggtgcagcccgcaggcgctcctgcag
caggtgatcgaggcggcggagaagtacggcgtgccgctgtcgggcgagaacgcgctgcag
cggtacgacgactacgcgttcgagcgcattgcggagagcgcttttgggcgcaacgcgcgg
gcggggcggctgacgcaggttacgttcctgcgcatgggcgacctgatgtttgacaactgg
gacgccttctcgcgcttcctcaaccgcatgcggaacaaggcgtga

DBGET integrated database retrieval system