KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_183481Help
Entry
CHLREDRAFT_183481 CDS       T01039                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
cre  Chlamydomonas reinhardtii
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cre00010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 282 aa AA seqDB search
MDSLQNVTLKTQSGQTAVVSAYAGHLLSWTNAEGQDYIFMSKNAVFAPPKAIRGGVPVCF
PQFSNFGPLGQQHGFVRNKQWRLVESNEWSVTLSYSYDGTEFPDYPYPFELTTRVELCDD
NLEQTLTVKNTGSAPMPFTAALHTYYTVSDIANVSVEGLKGLTYLDSTDGRKEKAEAHEA
VAFPGEVDRIYLRAPEVIKIHDSGAPGGGRTYEVRKRGFPDAVLWNPAEAKAAAMSDLGS
PEWKRMVCLEPGLVVSDPVQLAAGESWSGAQGLRVHRAGVKL
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atggacagcttgcagaacgtgacgctcaagacgcagtcgggccagacggctgtggtgtcc
gcctacgcgggacacctgctgtcttggaccaacgctgagggccaggactacatcttcatg
agtaagaacgcggtgtttgcaccgcccaaggccatccgcggcggcgtgccggtctgcttc
ccccagttctccaacttcgggcccctgggccagcagcacgggttcgtgcgcaacaagcag
tggcgcctggtggagagcaacgagtggtccgtgacgctgtcgtacagctatgacggcacg
gagtttccggactacccgtaccccttcgagctgacaacgcgtgtggagctgtgcgacgac
aacctggagcagaccctcacggtcaagaacacgggctccgcgcccatgcccttcaccgcc
gcgctgcacacctactacaccgtcagcgacatcgccaacgtcagcgtggagggactcaag
ggcctcacgtacctggacagcaccgacggccgcaaggagaaggcggaggcgcacgaggcg
gtggccttccccggcgaggtggaccgcatctacctacgtgcgccggaggtcatcaagatc
cacgactcgggcgcgccgggcggcgggcgcacctacgaggtccgcaagcgcggcttcccg
gacgccgtgctgtggaacccggctgaggccaaggcggcggccatgtcggacctggggtcg
cccgagtggaagcgcatggtgtgcctggagcccgggctggtggtgtcggacccggtgcag
ctggcggccggtgagagctggagcggcgcgcagggcctgcgggtgcaccgggcgggcgtc
aagctttga

DBGET integrated database retrieval system