KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_183481Help
Entry
CHLREDRAFT_183481 CDS       T01039                                 

Definition
(RefSeq) predicted protein
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
cre  Chlamydomonas reinhardtii
Pathway
cre00010  Glycolysis / Gluconeogenesis
cre01100  Metabolic pathways
cre01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cre00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CHLREDRAFT_183481
Enzymes [BR:cre01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     CHLREDRAFT_183481
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-GeneID: 5718028
NCBI-ProteinID: XP_001692444
JGI: 183481
UniProt: A8ITZ0
Position
Unknown
AA seq 282 aa AA seqDB search
MDSLQNVTLKTQSGQTAVVSAYAGHLLSWTNAEGQDYIFMSKNAVFAPPKAIRGGVPVCF
PQFSNFGPLGQQHGFVRNKQWRLVESNEWSVTLSYSYDGTEFPDYPYPFELTTRVELCDD
NLEQTLTVKNTGSAPMPFTAALHTYYTVSDIANVSVEGLKGLTYLDSTDGRKEKAEAHEA
VAFPGEVDRIYLRAPEVIKIHDSGAPGGGRTYEVRKRGFPDAVLWNPAEAKAAAMSDLGS
PEWKRMVCLEPGLVVSDPVQLAAGESWSGAQGLRVHRAGVKL
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atggacagcttgcagaacgtgacgctcaagacgcagtcgggccagacggctgtggtgtcc
gcctacgcgggacacctgctgtcttggaccaacgctgagggccaggactacatcttcatg
agtaagaacgcggtgtttgcaccgcccaaggccatccgcggcggcgtgccggtctgcttc
ccccagttctccaacttcgggcccctgggccagcagcacgggttcgtgcgcaacaagcag
tggcgcctggtggagagcaacgagtggtccgtgacgctgtcgtacagctatgacggcacg
gagtttccggactacccgtaccccttcgagctgacaacgcgtgtggagctgtgcgacgac
aacctggagcagaccctcacggtcaagaacacgggctccgcgcccatgcccttcaccgcc
gcgctgcacacctactacaccgtcagcgacatcgccaacgtcagcgtggagggactcaag
ggcctcacgtacctggacagcaccgacggccgcaaggagaaggcggaggcgcacgaggcg
gtggccttccccggcgaggtggaccgcatctacctacgtgcgccggaggtcatcaagatc
cacgactcgggcgcgccgggcggcgggcgcacctacgaggtccgcaagcgcggcttcccg
gacgccgtgctgtggaacccggctgaggccaaggcggcggccatgtcggacctggggtcg
cccgagtggaagcgcatggtgtgcctggagcccgggctggtggtgtcggacccggtgcag
ctggcggccggtgagagctggagcggcgcgcagggcctgcgggtgcaccgggcgggcgtc
aagctttga

DBGET integrated database retrieval system