KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_183928Help
Entry
CHLREDRAFT_183928 CDS       T01039                                 

Gene name
DCA1
Definition
S-adenosylmethionine decarboxylase (EC:4.1.1.50)
Orthology
K01611  
S-adenosylmethionine decarboxylase [EC:4.1.1.50]
Organism
cre  Chlamydomonas reinhardtii
Pathway
Cysteine and methionine metabolism
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cre00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    CHLREDRAFT_183928 (DCA1)
   00330 Arginine and proline metabolism
    CHLREDRAFT_183928 (DCA1)
Enzymes [BR:cre01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.50  adenosylmethionine decarboxylase
     CHLREDRAFT_183928 (DCA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 390 aa AA seqDB search
MTVNENGVLHMPIFEGSEKRIEVDFRLGPNVPANGLRSIPRETLDELMTLARCCIVSSRS
NDKLDAYVLSESSLFVYPTKWILKTCGTTRLLNSVPRLLEVARSIGLEPRRCKYTRASFL
FPENQPFPYTAFEHEVGFLDEHFGAMCANGGTAFMLGEPYQGLQWHVYLADDMLPLGPEF
KPTYNFEVTMTDLGTEAAAQFFRDNNPKFVSAERTTKDTGIAELKPKAIIDDYVFEPCGY
SMNGIDNTGLITIHVTPEAHQSYASVEFSGFGEDLMAPVQELLNKVVKIFAPGKVSVTMS
VDKVDMDATGCWGNLTMCPAGFGLQGASSQVSPCGGKVAYYTLIEKLAAPGSPITPLHHA
ASFLSIVTSSDSEADNGSEPEREIVTTATA
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtgaacgagaatggtgtcctgcacatgcctatcttcgagggcagcgagaagcgc
atcgaggtggacttccgcctcggccccaacgtgcccgccaatggcctccgctccatcccg
cgcgagacgctggacgagctgatgaccctggcgcgctgctgcatcgtgtcgtcgcgcagc
aacgacaagctggacgcgtacgtgctgtctgagagcagcctcttcgtgtaccccacgaag
tggattctgaagacctgcggcactacacgcctgctgaactcggtgccgcgcctgctggag
gtggcgcgctccattggtctggagccccgccgctgcaagtacacgcgtgccagcttcctc
ttcccggagaaccagcccttcccctacactgccttcgagcacgaggtgggcttcctggac
gagcactttggcgccatgtgcgccaacggcggcaccgccttcatgctgggcgagccctac
cagggcctgcagtggcacgtgtacctggcggacgacatgctgccgctgggccccgagttc
aagcccacctacaacttcgaggtgacgatgacggacctgggcaccgaggcggccgcgcag
ttcttccgcgacaacaaccccaagtttgtctcggcggagcgcaccaccaaggacaccggc
atcgctgagctcaagcccaaggccatcatcgacgactacgtctttgagccgtgcggctac
tcgatgaacggcattgacaacaccggactgatcaccattcacgtgacgccggaggcgcac
cagagctacgcgtcggttgagttttcgggctttggggaggacctgatggcgccggtccag
gagctgctgaacaaggtggtcaagatcttcgcgccgggcaaagtctcggtgaccatgtct
gtggacaaggtcgatatggacgcgacgggctgctggggcaacctgacgatgtgccccgcg
ggcttcggcctgcagggcgcctcgagccaggtcagcccctgcggcggcaaggtggcgtac
tacacgctgattgagaagctggcggcgcccggctccccgatcacgcccctgcaccacgcc
gcgtccttcctgtccattgtcacgtcctcggactccgaggcggacaatggcagcgagccc
gagcgcgagatcgttaccaccgccacggcctga

DBGET integrated database retrieval system