KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_185774Help
Entry
CHLREDRAFT_185774 CDS       T01039                                 

Definition
hypothetical protein
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
cre  Chlamydomonas reinhardtii
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:cre00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CHLREDRAFT_185774
   00240 Pyrimidine metabolism
    CHLREDRAFT_185774
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    CHLREDRAFT_185774
   03410 Base excision repair
    CHLREDRAFT_185774
   03420 Nucleotide excision repair
    CHLREDRAFT_185774
   03430 Mismatch repair
    CHLREDRAFT_185774
   03440 Homologous recombination
    CHLREDRAFT_185774
DNA repair and recombination proteins [BR:cre03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      CHLREDRAFT_185774
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 136 aa AA seqDB search
MMSSKKDSSKDAKLSSVYRQAKPGAPVGPATPAKTTRASGKRKAQELENATPAPEVLARS
QGEGAVSRADLSQDEQKLRKFDLTTKFGPCAGISRLERWERAAKFGLGPPEEVRAIILAA
GGAGSAADKGLWHERV
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgatgagctctaagaaagattcaagcaaggatgccaagctttcaagcgtctatcgccaa
gcaaagccgggcgcgccagttgggcccgcaactccggcgaaaaccactcgcgctagtggc
aagcggaaggcgcaggagctcgagaatgcaacgccagccccagaagttctggctcgtagc
cagggcgaaggcgctgtttcgcgagcggacctgagccaggacgagcagaagctacgcaag
tttgacctgacaaccaagttcgggccttgcgctggcatcagccggttagagaggtgggag
cgtgccgccaagttcggactggggccccctgaggaggtgcgggctatcatcctggccgcg
ggaggtgcgggcagcgcagcggacaaagggctgtggcacgagcgcgtgtag

DBGET integrated database retrieval system