KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_185774Help
Entry
CHLREDRAFT_185774 CDS       T01039                                 

Definition
hypothetical protein
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
cre  Chlamydomonas reinhardtii
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cre00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CHLREDRAFT_185774
   00240 Pyrimidine metabolism
    CHLREDRAFT_185774
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    CHLREDRAFT_185774
   03410 Base excision repair
    CHLREDRAFT_185774
   03420 Nucleotide excision repair
    CHLREDRAFT_185774
   03430 Mismatch repair
    CHLREDRAFT_185774
   03440 Homologous recombination
    CHLREDRAFT_185774
DNA repair and recombination proteins [BR:cre03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      CHLREDRAFT_185774
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 136 aa AA seqDB search
MMSSKKDSSKDAKLSSVYRQAKPGAPVGPATPAKTTRASGKRKAQELENATPAPEVLARS
QGEGAVSRADLSQDEQKLRKFDLTTKFGPCAGISRLERWERAAKFGLGPPEEVRAIILAA
GGAGSAADKGLWHERV
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgatgagctctaagaaagattcaagcaaggatgccaagctttcaagcgtctatcgccaa
gcaaagccgggcgcgccagttgggcccgcaactccggcgaaaaccactcgcgctagtggc
aagcggaaggcgcaggagctcgagaatgcaacgccagccccagaagttctggctcgtagc
cagggcgaaggcgctgtttcgcgagcggacctgagccaggacgagcagaagctacgcaag
tttgacctgacaaccaagttcgggccttgcgctggcatcagccggttagagaggtgggag
cgtgccgccaagttcggactggggccccctgaggaggtgcgggctatcatcctggccgcg
ggaggtgcgggcagcgcagcggacaaagggctgtggcacgagcgcgtgtag

DBGET integrated database retrieval system