KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_186639Help
Entry
CHLREDRAFT_186639 CDS       T01039                                 

Gene name
ALAD
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
cre  Chlamydomonas reinhardtii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cre00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CHLREDRAFT_186639 (ALAD)
Enzymes [BR:cre01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     CHLREDRAFT_186639 (ALAD)
Exosome [BR:cre04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CHLREDRAFT_186639 (ALAD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 390 aa AA seqDB search
MQMMQRNVVGQRPVAGSRRSLVVANVAEVTRPAVSTNGKHRTGVPEGTPIVTPQDLPSRP
RRNRRSESFRASVREVNVSPANFILPIFIHEESNQNVPIASMPGINRLAYGKNVIDYVAE
ARSYGVNQVVVFPKTPDHLKTQTAEEAFNKNGLSQRTIRLLKDSFPDLEVYTDVALDPYN
SDGHDGIVSDAGVILNDETIEYLCRQAVSQAEAGADVVSPSDMMDGRVGAIRRALDREGF
TNVSIMSYTAKYASAYYGPFRDALASAPKPGQAHRRIPPNKKTYQMDPANYREAIREAKA
DEAEGADIMMVKPGMPYLDVVRLLRETSPLPVAVYHVSGEYAMLKAAAERGWLNEKDAVL
EAMTCFRRAGADLILTYYGIEASKWLAGEK
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgcagatgatgcagcgcaacgttgtgggccagcgccccgtcgctggctcccgccgctcg
ctggtggttgccaacgttgcggaggtgacccgccccgcggtcagcaccaacggcaagcac
cggactggtgtgccggagggaactcccatcgtcacccctcaggacctgccctcgcgccct
cgccgcaaccgccgcagcgagagcttccgtgcttccgttcgtgaggtgaacgtgtcgccc
gccaacttcatcctgccgatcttcatccacgaggagagcaaccagaacgtgcccatcgcc
tccatgcctggcatcaaccgcctggcgtatggcaagaacgtgattgactacgttgctgag
gctcgctcttacggtgtcaaccaggtcgtggttttccccaagacgcccgaccacctgaag
acgcaaaccgcggaggaggcgttcaacaagaacggcctcagccagcgcacgatccgcctg
ctgaaggactctttccctgacctggaggtgtacacggacgtggctctggacccctacaac
tcggacggccacgacggtatcgtgtcggacgccggtgtgatcctgaacgacgagaccatc
gagtacctgtgccgccaggccgtgagccaggccgaggccggtgccgacgtggtgtcgccc
tctgacatgatggacggccgcgtgggcgccatccgccgcgccctggaccgcgagggcttc
accaacgtgtccatcatgtcctacaccgccaagtacgcctccgcctactacggccccttc
cgtgacgccctggcgtccgcgcccaagcccggccaggcgcaccgccgcatcccccccaac
aagaagacctaccagatggaccccgccaactaccgcgaggccatccgcgaggccaaggcc
gacgaggccgagggcgctgacatcatgatggtcaagcccggcatgccgtacctggacgtg
gtacgcctgctgcgtgagaccagcccgctgcccgtggccgtgtaccacgtgtcgggcgag
tacgccatgctcaaggcggcggcggagcgcggctggctgaacgagaaggatgccgtgctt
gaggccatgacctgcttccgccgcgccggcgctgacctcatcctcacctactacggcatt
gaggcctccaagtggctggcgggcgagaagtaa

DBGET integrated database retrieval system